Homologs in group_1463

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08685 FBDBKF_08685 82.0 Morganella morganii S1 rpsO 30S ribosomal protein S15
EHELCC_12840 EHELCC_12840 82.0 Morganella morganii S2 rpsO 30S ribosomal protein S15
NLDBIP_13180 NLDBIP_13180 82.0 Morganella morganii S4 rpsO 30S ribosomal protein S15
LHKJJB_13375 LHKJJB_13375 82.0 Morganella morganii S3 rpsO 30S ribosomal protein S15
HKOGLL_11655 HKOGLL_11655 82.0 Morganella morganii S5 rpsO 30S ribosomal protein S15
F4V73_RS09910 F4V73_RS09910 83.1 Morganella psychrotolerans rpsO 30S ribosomal protein S15

Distribution of the homologs in the orthogroup group_1463

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1463

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2C2 4.44e-59 178 100 0 89 3 rpsO Small ribosomal subunit protein uS15 Proteus mirabilis (strain HI4320)
P66431 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66432 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella typhi
B4TWD4 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella schwarzengrund (strain CVM19633)
B5BGJ2 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi A (strain AKU_12601)
C0PZ51 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi C (strain RKS4594)
A9N729 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLB3 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T6Z5 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella newport (strain SL254)
B4TJ03 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella heidelberg (strain SL476)
B5REN3 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZV5 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella enteritidis PT4 (strain P125109)
B5FI10 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella dublin (strain CT_02021853)
Q57JI2 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella choleraesuis (strain SC-B67)
B5F6T5 2.37e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Salmonella agona (strain SL483)
Q3YX76 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella sonnei (strain Ss046)
P0ADZ6 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella flexneri
Q0T0B6 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella flexneri serotype 5b (strain 8401)
Q32BG8 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella dysenteriae serotype 1 (strain Sd197)
Q31W44 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella boydii serotype 4 (strain Sb227)
B2U210 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LR34 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R6H3 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain UTI89 / UPEC)
B1LFR7 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1P0 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain SE11)
B7NDF1 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ADZ4 3.48e-53 163 88 0 89 1 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain K12)
B1IQV6 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ADZ5 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCU4 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AG70 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O1:K1 / APEC
A8A4Y1 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O9:H4 (strain HS)
B1XGX7 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain K12 / DH10B)
C4ZSQ6 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M073 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O8 (strain IAI1)
B7N0V0 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O81 (strain ED1a)
B7NKN4 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LGI7 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli (strain 55989 / EAEC)
B7MB86 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJ60 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZS62 3.48e-53 163 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O139:H28 (strain E24377A / ETEC)
O34274 7.83e-53 162 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia enterocolitica
A1JIX2 7.83e-53 162 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5YS55 7.92e-53 162 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X9M2 7.92e-53 162 88 0 89 3 rpsO Small ribosomal subunit protein uS15 Escherichia coli O157:H7
C5BFC0 8.27e-53 162 87 0 89 3 rpsO Small ribosomal subunit protein uS15 Edwardsiella ictaluri (strain 93-146)
A8G910 8.03e-52 159 87 0 89 3 rpsO Small ribosomal subunit protein uS15 Serratia proteamaculans (strain 568)
A4WEY0 1.57e-51 159 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Enterobacter sp. (strain 638)
A8AQ54 1.57e-51 159 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P41120 2.16e-51 159 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Photorhabdus luminescens
C6DKK6 2.18e-51 159 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B1JLX7 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F57 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRI0 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis (strain Pestoides F)
Q1CEL6 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5A6 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBC5 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis
B2K2Q8 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CC10 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMR9 2.35e-51 158 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7MYY9 5.61e-51 157 86 0 89 3 rpsO Small ribosomal subunit protein uS15 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TEI4 8.23e-51 157 85 0 89 3 rpsO Small ribosomal subunit protein uS15 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSX7 1.32e-50 156 85 0 89 3 rpsO Small ribosomal subunit protein uS15 Klebsiella pneumoniae (strain 342)
Q6D9A2 1.64e-50 156 85 0 89 3 rpsO Small ribosomal subunit protein uS15 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VGN5 4.42e-50 155 84 0 89 3 rpsO Small ribosomal subunit protein uS15 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NW20 1.84e-48 151 82 0 89 3 rpsO Small ribosomal subunit protein uS15 Sodalis glossinidius (strain morsitans)
B8F5Z2 3.49e-47 148 82 0 89 3 rpsO Small ribosomal subunit protein uS15 Glaesserella parasuis serovar 5 (strain SH0165)
B0BPU4 3.49e-47 148 82 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1N7 3.49e-47 148 82 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N113 3.49e-47 148 82 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0USL5 2.81e-46 145 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Histophilus somni (strain 2336)
Q0I275 2.81e-46 145 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Histophilus somni (strain 129Pt)
A6VQB6 6.06e-46 145 79 0 89 3 rpsO Small ribosomal subunit protein uS15 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QKJ8 1.11e-45 144 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus influenzae (strain 86-028NP)
Q7VKX3 1.38e-45 144 79 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65UQ4 1.65e-45 144 79 0 89 3 rpsO Small ribosomal subunit protein uS15 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44389 2.07e-45 143 80 0 89 3 rpsO1 Small ribosomal subunit protein uS15 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEY4 2.07e-45 143 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus influenzae (strain PittGG)
A5UC84 2.2e-45 144 80 0 89 3 rpsO Small ribosomal subunit protein uS15 Haemophilus influenzae (strain PittEE)
A9KZW8 3.36e-45 143 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS195)
A3D7K3 3.36e-45 143 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6N5 3.36e-45 143 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS223)
A6WRG5 3.4e-45 143 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella baltica (strain OS185)
Q086G9 2.98e-44 140 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella frigidimarina (strain NCIMB 400)
Q0HXR2 3.68e-44 140 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain MR-7)
Q0HLF8 3.68e-44 140 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain MR-4)
A0KTZ9 3.68e-44 140 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain ANA-3)
Q9CNX1 5.11e-44 140 78 0 89 3 rpsO Small ribosomal subunit protein uS15 Pasteurella multocida (strain Pm70)
A1RGX8 5.52e-44 140 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sp. (strain W3-18-1)
A4Y9B7 5.52e-44 140 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KNE0 1.42e-43 139 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q12QH8 1.55e-43 139 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8EHL3 1.87e-43 139 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4SJR8 3.26e-43 138 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Aeromonas salmonicida (strain A449)
C4L8X1 4.49e-43 137 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A1ST52 4.54e-43 137 77 0 89 3 rpsO Small ribosomal subunit protein uS15 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8CKH6 7.35e-43 137 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H737 2.18e-42 136 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQ99 2.18e-42 136 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella halifaxensis (strain HAW-EB4)
C3LSQ1 2.96e-42 135 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio cholerae serotype O1 (strain M66-2)
Q9KU77 2.96e-42 135 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F929 2.96e-42 135 76 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A1S465 3.69e-42 135 75 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B5FA82 8.7e-41 132 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Aliivibrio fischeri (strain MJ11)
Q5E7L2 8.7e-41 132 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ENE5 1.63e-40 131 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Aliivibrio salmonicida (strain LFI1238)
Q7MI12 3.21e-40 130 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio vulnificus (strain YJ016)
Q8DBV5 3.21e-40 130 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio vulnificus (strain CMCP6)
Q87M05 3.28e-40 130 73 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A3QGU2 3.28e-40 130 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1KRQ7 3.7e-40 130 70 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella woodyi (strain ATCC 51908 / MS32)
B7VJH4 9.4e-40 129 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Vibrio atlanticus (strain LGP32)
Q5QTZ1 1.34e-39 129 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1LSL1 2.5e-39 128 71 0 89 3 rpsO Small ribosomal subunit protein uS15 Baumannia cicadellinicola subsp. Homalodisca coagulata
A8FYR7 2.61e-39 128 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Shewanella sediminis (strain HAW-EB3)
Q6LUI9 4.32e-39 127 70 0 89 3 rpsO Small ribosomal subunit protein uS15 Photobacterium profundum (strain SS9)
Q1IF40 1.15e-38 126 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas entomophila (strain L48)
Q3IJ74 1.56e-38 126 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudoalteromonas translucida (strain TAC 125)
Q88DV9 2.01e-38 126 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W984 2.01e-38 126 69 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q15V69 2.19e-38 125 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1J2B2 9.63e-38 124 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain W619)
B0KHX5 9.63e-38 124 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida (strain GB-1)
C4K3E7 1.7e-37 123 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q4ZNR5 2.1e-37 123 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas syringae pv. syringae (strain B728a)
Q87WQ7 2.1e-37 123 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48E80 2.1e-37 123 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1QSZ3 2.24e-37 123 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3KI81 4.38e-37 122 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas fluorescens (strain Pf0-1)
Q0A7A0 4.52e-37 122 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B4RXU2 6.94e-37 122 68 0 89 3 rpsO Small ribosomal subunit protein uS15 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q21H64 1.12e-36 121 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4XYD7 1.37e-36 121 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas mendocina (strain ymp)
Q482T6 1.38e-36 121 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C5BPV6 1.48e-36 121 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B3PI99 1.67e-36 121 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Cellvibrio japonicus (strain Ueda107)
Q2SZP0 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63VN8 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain K96243)
A3N7L2 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain 668)
Q3JUB4 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain 1710b)
A3NTA0 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia pseudomallei (strain 1106a)
A1V2L1 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain SAVP1)
Q62IN0 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain ATCC 23344)
A2S464 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain NCTC 10229)
A3MI96 1.99e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia mallei (strain NCTC 10247)
Q0VSR8 3.05e-36 120 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q9HV58 3.63e-36 120 67 0 89 1 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02FT1 3.63e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1F3 3.63e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain LESB58)
A6VCJ8 3.63e-36 120 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas aeruginosa (strain PA7)
Q4KIF3 4.38e-36 120 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0VEA4 6.79e-36 119 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain AYE)
A3M1M6 6.79e-36 119 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VLR8 6.79e-36 119 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain SDF)
B2I2P9 6.79e-36 119 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain ACICU)
B7I3U0 6.79e-36 119 66 0 89 1 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain AB0057)
B7H0Z2 6.79e-36 119 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baumannii (strain AB307-0294)
Q6FF13 8.84e-36 119 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B2U7R7 9.65e-36 119 67 0 89 3 rpsO Small ribosomal subunit protein uS15 Ralstonia pickettii (strain 12J)
B8GP05 1.51e-35 119 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A6VU32 1.6e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Marinomonas sp. (strain MWYL1)
A1WXU8 1.78e-35 118 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Halorhodospira halophila (strain DSM 244 / SL1)
A4JGD5 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BV08 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia orbicola (strain AU 1054)
B1JVP6 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia orbicola (strain MC0-3)
A9AJN9 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39EE0 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BDC5 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5M7 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K928 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia cenocepacia (strain HI2424)
B1YTR2 2.29e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Burkholderia ambifaria (strain MC40-6)
A4VPN7 2.62e-35 118 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Stutzerimonas stutzeri (strain A1501)
Q8UJ54 3.26e-35 117 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Agrobacterium fabrum (strain C58 / ATCC 33970)
B2JDN3 3.97e-35 117 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q142H8 4.04e-35 117 65 0 88 3 rpsO Small ribosomal subunit protein uS15 Paraburkholderia xenovorans (strain LB400)
Q47D97 4.1e-35 117 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Dechloromonas aromatica (strain RCB)
Q1GXD3 9.44e-35 116 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1K7B6 1.71e-34 116 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Azoarcus sp. (strain BH72)
B8IGX2 2.17e-34 115 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
C1DFK6 2.48e-34 115 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A9IGJ8 2.73e-34 115 66 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A9BNB9 3.38e-34 115 64 0 87 3 rpsO Small ribosomal subunit protein uS15 Delftia acidovorans (strain DSM 14801 / SPH-1)
C3K256 3.52e-34 115 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas fluorescens (strain SBW25)
Q2KWI4 4.19e-34 115 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella avium (strain 197N)
Q7VZU1 4.33e-34 115 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W569 4.33e-34 115 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WCP9 4.33e-34 115 65 0 89 3 rpsO Small ribosomal subunit protein uS15 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1W4L7 4.65e-34 115 64 0 87 3 rpsO Small ribosomal subunit protein uS15 Acidovorax sp. (strain JS42)
B9MEK9 4.65e-34 115 64 0 87 3 rpsO Small ribosomal subunit protein uS15 Acidovorax ebreus (strain TPSY)
A5WBT1 5.48e-34 114 62 0 87 3 rpsO Small ribosomal subunit protein uS15 Psychrobacter sp. (strain PRwf-1)
A1U5Z7 6.65e-34 114 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B1LZQ2 6.8e-34 114 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A1TLL1 7.21e-34 114 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Paracidovorax citrulli (strain AAC00-1)
A6UF33 7.92e-34 114 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Sinorhizobium medicae (strain WSM419)
Q92SW1 1.19e-33 114 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium meliloti (strain 1021)
Q0AK63 1.28e-33 114 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Maricaulis maris (strain MCS10)
Q2Y5X8 2.03e-33 113 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8XXP4 2.1e-33 113 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C5CT25 2.54e-33 113 64 0 87 3 rpsO Small ribosomal subunit protein uS15 Variovorax paradoxus (strain S110)
B1Y822 2.64e-33 113 64 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q11BC4 2.71e-33 113 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Chelativorans sp. (strain BNC1)
C1D8W9 3.33e-33 112 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Laribacter hongkongensis (strain HLHK9)
A1WLP9 3.46e-33 112 64 0 87 3 rpsO Small ribosomal subunit protein uS15 Verminephrobacter eiseniae (strain EF01-2)
A4IME2 3.56e-33 112 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Geobacillus thermodenitrificans (strain NG80-2)
Q5L0I3 4.01e-33 112 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Geobacillus kaustophilus (strain HTA426)
Q4FVL1 4.4e-33 112 60 0 87 3 rpsO Small ribosomal subunit protein uS15 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B9DTE2 4.48e-33 112 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q2NBZ3 5.28e-33 112 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Erythrobacter litoralis (strain HTCC2594)
B2FN87 5.35e-33 112 64 1 89 3 rpsO Small ribosomal subunit protein uS15 Stenotrophomonas maltophilia (strain K279a)
B4SQR7 5.35e-33 112 64 1 89 3 rpsO Small ribosomal subunit protein uS15 Stenotrophomonas maltophilia (strain R551-3)
C0ZF45 6.16e-33 112 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A4G648 6.22e-33 112 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Herminiimonas arsenicoxydans
C4L6J5 7.75e-33 112 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q3SKX4 8.28e-33 112 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Thiobacillus denitrificans (strain ATCC 25259)
Q1QEP0 8.68e-33 111 60 0 87 3 rpsO Small ribosomal subunit protein uS15 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B0TZ10 8.68e-33 111 65 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B0UEX4 1.09e-32 111 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylobacterium sp. (strain 4-46)
C3MC70 1.13e-32 111 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q5LLT1 1.14e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3R3W1 1.33e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KCT5 1.33e-32 111 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
C5D9D4 1.4e-32 111 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Geobacillus sp. (strain WCH70)
Q5NZR8 1.55e-32 111 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A7IC04 1.69e-32 111 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A1AMM5 2.6e-32 110 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q9KA82 2.95e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B8D7R1 2.98e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57455 2.98e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9F9 2.98e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q3J9B9 3.02e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4WWP1 3.29e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
C0MFA8 3.93e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus equi subsp. zooepidemicus (strain H70)
Q1J4M6 3.93e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M4 (strain MGAS10750)
B4U574 3.93e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M9D9 3.93e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus equi subsp. equi (strain 4047)
Q2KDZ9 4.1e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PXD9 4.1e-32 110 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium etli (strain CIAT 652)
Q82XS9 4.1e-32 110 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B5XIK9 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE75 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48R96 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RGH7 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JEW0 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJW9 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9S0 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMR3 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9V4 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE74 4.43e-32 110 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q609C5 4.58e-32 110 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5GXV2 5.17e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SVK0 5.17e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0X4 5.17e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRP8 5.17e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PJ58 5.17e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas axonopodis pv. citri (strain 306)
Q0BPK2 5.28e-32 109 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q1LPW9 5.7e-32 109 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3IYT8 5.76e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PNF9 5.76e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q2SML0 5.83e-32 109 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Hahella chejuensis (strain KCTC 2396)
Q473U8 5.95e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C6C0C8 6.15e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q18BI0 6.26e-32 109 65 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridioides difficile (strain 630)
Q8P7V0 6.3e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRB7 6.3e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas campestris pv. campestris (strain B100)
Q4UW99 6.3e-32 109 62 1 89 3 rpsO Small ribosomal subunit protein uS15 Xanthomonas campestris pv. campestris (strain 8004)
Q493T4 7.41e-32 109 60 0 88 3 rpsO Small ribosomal subunit protein uS15 Blochmanniella pennsylvanica (strain BPEN)
Q03MP3 7.58e-32 109 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M6A7 7.58e-32 109 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1R6 7.58e-32 109 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus thermophilus (strain CNRZ 1066)
Q39VA2 7.69e-32 109 62 0 87 3 rpsO Small ribosomal subunit protein uS15 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9JGT0 8.46e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1ZGS8 8.46e-32 109 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q02WW4 1.02e-31 109 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactococcus lactis subsp. cremoris (strain SK11)
A2RMV9 1.02e-31 109 58 0 89 1 rpsO Small ribosomal subunit protein uS15 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CEF6 1.02e-31 109 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactococcus lactis subsp. lactis (strain IL1403)
Q5WFU7 1.11e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Shouchella clausii (strain KSM-K16)
A4SXQ8 1.17e-31 108 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q99XZ0 1.25e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pyogenes serotype M1
Q8K9H4 1.3e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B5ZW25 1.48e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q21YD2 1.68e-31 108 60 0 87 3 rpsO Small ribosomal subunit protein uS15 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q30WI6 1.72e-31 108 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A8IGA5 1.74e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P05766 1.78e-31 108 59 0 89 1 rpsO Small ribosomal subunit protein uS15 Geobacillus stearothermophilus
Q7NY11 1.86e-31 108 64 0 89 3 rpsO Small ribosomal subunit protein uS15 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8E1Z9 1.99e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7F7 1.99e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3H0 1.99e-31 108 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q1MN43 2.08e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0AE54 2.1e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q98BI4 2.27e-31 108 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A0AID1 2.27e-31 108 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92C24 2.27e-31 108 61 0 89 1 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DFZ7 2.27e-31 108 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZZ2 2.27e-31 108 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serotype 4b (strain F2365)
C1L2N6 2.27e-31 108 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q7ANZ1 2.27e-31 108 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q89AF7 2.29e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q127W7 2.3e-31 108 67 0 82 3 rpsO Small ribosomal subunit protein uS15 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q65JH6 2.56e-31 108 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B8GWZ1 2.85e-31 108 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AC31 2.85e-31 108 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A9W8P9 3.4e-31 107 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylorubrum extorquens (strain PA1)
B7KN56 3.4e-31 107 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A4IZA7 3.9e-31 107 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGX8 3.9e-31 107 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SDK9 3.9e-31 107 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14ID0 3.9e-31 107 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. tularensis (strain FSC 198)
A8FDD6 4.1e-31 107 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus pumilus (strain SAFR-032)
A7Z4T9 5.16e-31 107 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A0Q5I8 5.53e-31 107 63 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. novicida (strain U112)
O87791 6.15e-31 107 62 0 89 3 rpsO Small ribosomal subunit protein uS15 Pseudomonas putida
B0T174 6.57e-31 107 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Caulobacter sp. (strain K31)
Q1GVQ9 6.79e-31 107 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B1XUJ4 7.09e-31 107 61 0 89 3 rpsO Small ribosomal subunit protein uS15 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q82ZJ1 7.33e-31 107 57 0 89 1 rpsO Small ribosomal subunit protein uS15 Enterococcus faecalis (strain ATCC 700802 / V583)
A5VCY8 8.54e-31 106 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5GF90 8.67e-31 106 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Geotalea uraniireducens (strain Rf4)
B1N065 9.53e-31 106 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Leuconostoc citreum (strain KM20)
A1VM55 9.57e-31 106 60 0 87 3 rpsO Small ribosomal subunit protein uS15 Polaromonas naphthalenivorans (strain CJ2)
A8AV42 9.96e-31 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P21473 1.09e-30 106 58 0 89 1 rpsO Small ribosomal subunit protein uS15 Bacillus subtilis (strain 168)
B1YI58 1.12e-30 106 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A4VXR1 1.21e-30 106 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus suis (strain 05ZYH33)
A4W410 1.21e-30 106 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus suis (strain 98HAH33)
A1VG87 1.21e-30 106 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitratidesulfovibrio vulgaris (strain DP4)
Q72ER5 1.21e-30 106 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A6SY01 1.23e-30 106 60 0 89 3 rpsO Small ribosomal subunit protein uS15 Janthinobacterium sp. (strain Marseille)
C1CSP2 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLW8 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain P1031)
C1CFJ7 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain JJA)
Q8CWQ0 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IRD4 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain CGSP14)
Q97PI9 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZM28 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I700 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain Hungary19A-6)
C1C8L6 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae (strain 70585)
B5E6Q4 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae serotype 19F (strain G54)
Q04JE2 1.31e-30 106 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A7HZ96 1.37e-30 106 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q83D88 1.41e-30 106 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9ND63 1.41e-30 106 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFK5 1.41e-30 106 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain Dugway 5J108-111)
B6J6S6 1.41e-30 106 61 0 88 3 rpsO Small ribosomal subunit protein uS15 Coxiella burnetii (strain CbuK_Q154)
B9M1G4 1.48e-30 106 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q0BKU0 2.04e-30 105 62 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A268 2.04e-30 105 62 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. holarctica (strain LVS)
A7NDP4 2.04e-30 105 62 0 87 3 rpsO Small ribosomal subunit protein uS15 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9VT45 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus mycoides (strain KBAB4)
Q6HF07 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636L8 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain ZK / E33L)
Q819Z0 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A7GRD8 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HLE1 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain AH187)
B7HDT1 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain B4264)
C1EP30 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain 03BB102)
B7IUG6 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain G9842)
Q732R4 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJ85 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus cereus (strain AH820)
Q81WM7 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus anthracis
A0RHH9 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus thuringiensis (strain Al Hakam)
C3L7B9 2.05e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bacillus anthracis (strain CDC 684 / NRRL 3495)
B8EP10 2.14e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B8FCY9 2.29e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulfatibacillum aliphaticivorans
Q16CF2 2.88e-30 105 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5FQM0 2.98e-30 105 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Gluconobacter oxydans (strain 621H)
A3CQH4 3.15e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus sanguinis (strain SK36)
Q8EQT8 3.44e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B9DPD9 3.55e-30 105 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus carnosus (strain TM300)
Q1GKK2 4.05e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Ruegeria sp. (strain TM1040)
A1B5Q0 4.23e-30 105 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Paracoccus denitrificans (strain Pd 1222)
A1UU53 4.28e-30 105 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q03VU8 4.93e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A4YJF2 4.93e-30 104 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Bradyrhizobium sp. (strain ORS 278)
A9IMS2 5.5e-30 104 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B0THS1 5.57e-30 104 57 0 88 3 rpsO Small ribosomal subunit protein uS15 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q2G5F4 5.63e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q6G0P6 5.75e-30 104 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella quintana (strain Toulouse)
B9JYK9 6.42e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q3ABA4 6.63e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B3EAF1 7.19e-30 104 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q1DAM2 7.9e-30 104 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Myxococcus xanthus (strain DK1622)
Q8DWB3 9.63e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B7GG70 9.73e-30 104 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q04EG6 1.35e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B5YHN1 1.37e-29 103 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q0AYI3 1.37e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0LHM3 1.48e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q042T2 1.53e-29 103 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q74JU9 1.72e-29 103 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B5EMD3 1.96e-29 103 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4D7 1.96e-29 103 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q28K15 1.98e-29 103 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Jannaschia sp. (strain CCS1)
Q3A4A2 2.18e-29 103 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1A007 2.29e-29 103 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
A1SLJ5 2.34e-29 103 56 1 91 3 rpsO Small ribosomal subunit protein uS15 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q6G5F7 2.47e-29 103 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7A116 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain MW2)
A8Z3V3 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9U0 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain MSSA476)
Q6GHG2 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain MRSA252)
Q7A5X8 2.67e-29 103 57 0 89 1 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain N315)
Q99UJ9 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QGH2 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain Newman)
Q5HGF8 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain COL)
Q2YXP3 2.67e-29 103 57 0 89 1 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ISF7 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain JH9)
Q2G2Q1 2.67e-29 103 57 0 89 1 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHG5 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain USA300)
A6U192 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain JH1)
A7X1Q7 2.67e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B2ICY8 2.79e-29 103 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q2RJM0 2.82e-29 102 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A8LKE4 3.11e-29 102 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A5FVN5 3.25e-29 102 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Acidiphilium cryptum (strain JF-5)
B8J1Y0 3.59e-29 102 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B4RC49 3.71e-29 102 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Phenylobacterium zucineum (strain HLK1)
Q8F7J9 3.72e-29 102 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NX6 3.72e-29 102 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q49X61 3.79e-29 102 58 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q03F22 3.91e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
C0QHM5 4.04e-29 102 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q74CT0 4.48e-29 102 59 0 87 3 rpsO Small ribosomal subunit protein uS15 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q03QN2 4.93e-29 102 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1KWK2 5.19e-29 102 60 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Loch Maree / Type A3)
A7GG01 5.19e-29 102 60 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1II44 5.19e-29 102 60 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Okra / Type B1)
A5I4I8 5.19e-29 102 60 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FVY8 5.19e-29 102 60 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain ATCC 19397 / Type A)
B8DVV7 5.26e-29 102 59 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium animalis subsp. lactis (strain AD011)
Q6MMS3 5.32e-29 102 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q89WB2 5.87e-29 102 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5E869 6.2e-29 102 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A0Q0Q2 7.22e-29 102 59 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium novyi (strain NT)
B0U1R1 7.33e-29 102 60 1 89 3 rpsO Small ribosomal subunit protein uS15 Xylella fastidiosa (strain M12)
Q9PGR0 7.33e-29 102 60 1 89 3 rpsO Small ribosomal subunit protein uS15 Xylella fastidiosa (strain 9a5c)
Q4L5X6 7.64e-29 102 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus haemolyticus (strain JCSC1435)
B3QAB1 8.25e-29 101 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodopseudomonas palustris (strain TIE-1)
Q6NCN7 8.25e-29 101 53 0 89 1 rpsO Small ribosomal subunit protein uS15 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
C6E2P6 9.98e-29 101 59 0 87 3 rpsO Small ribosomal subunit protein uS15 Geobacter sp. (strain M21)
B5EI62 9.98e-29 101 59 0 87 3 rpsO Small ribosomal subunit protein uS15 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q8CST2 1.11e-28 101 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPR8 1.11e-28 101 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B1ZS99 1.11e-28 101 55 0 86 3 rpsO Small ribosomal subunit protein uS15 Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
B8DN08 1.32e-28 101 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8G448 1.36e-28 101 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium longum (strain NCC 2705)
B3DPW9 1.36e-28 101 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium longum (strain DJO10A)
A9HF29 1.38e-28 101 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A0LE15 1.64e-28 100 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q8RA42 1.67e-28 100 58 0 87 3 rpsO Small ribosomal subunit protein uS15 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B2TJ60 1.96e-28 100 59 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Eklund 17B / Type B)
A8MFB3 2e-28 100 59 0 84 3 rpsO Small ribosomal subunit protein uS15 Alkaliphilus oremlandii (strain OhILAs)
Q21C28 2e-28 100 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodopseudomonas palustris (strain BisB18)
Q50EJ9 2.07e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus reuteri
B2G6Q9 2.07e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ89 2.07e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus reuteri (strain DSM 20016)
Q5X1C6 2.17e-28 100 56 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila (strain Paris)
A6TRK2 2.21e-28 100 61 1 85 3 rpsO Small ribosomal subunit protein uS15 Alkaliphilus metalliredigens (strain QYMF)
B1HR10 2.28e-28 100 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Lysinibacillus sphaericus (strain C3-41)
Q3SWP6 2.33e-28 100 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
O86655 2.51e-28 100 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2LWU2 2.99e-28 100 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Syntrophus aciditrophicus (strain SB)
B6JCR9 3.43e-28 100 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q04ZJ8 3.6e-28 100 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04U28 3.6e-28 100 56 0 87 3 rpsO Small ribosomal subunit protein uS15 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B2V4H4 3.69e-28 100 58 0 82 3 rpsO Small ribosomal subunit protein uS15 Clostridium botulinum (strain Alaska E43 / Type E3)
Q1IQ55 3.84e-28 100 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Koribacter versatilis (strain Ellin345)
Q87EV1 3.92e-28 100 59 1 89 3 rpsO Small ribosomal subunit protein uS15 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I729 3.92e-28 100 59 1 89 3 rpsO Small ribosomal subunit protein uS15 Xylella fastidiosa (strain M23)
B7GNH3 4.27e-28 100 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B2GBB8 4.31e-28 100 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q38WR4 4.31e-28 100 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Latilactobacillus sakei subsp. sakei (strain 23K)
Q2J2J5 4.46e-28 100 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodopseudomonas palustris (strain HaA2)
Q1QS61 4.66e-28 99 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q5NQ31 4.71e-28 99 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2RMR7 5.43e-28 99 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C0ZYB6 5.43e-28 99 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B0K1D1 5.51e-28 99 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Thermoanaerobacter sp. (strain X514)
B0K9P5 5.51e-28 99 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A4FM23 5.73e-28 99 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A7H9F7 5.92e-28 99 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter sp. (strain Fw109-5)
Q24UJ1 6.08e-28 99 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Desulfitobacterium hafniense (strain Y51)
C4XJA5 6.33e-28 99 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A9NGE3 7.38e-28 99 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Acholeplasma laidlawii (strain PG-8A)
Q13EM1 7.54e-28 99 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Rhodopseudomonas palustris (strain BisB5)
A3DCH6 8.04e-28 99 55 0 87 3 rpsO Small ribosomal subunit protein uS15 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q6AJY8 8.69e-28 99 56 0 89 3 rpsO Small ribosomal subunit protein uS15 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q6AFQ4 1.01e-27 99 57 0 89 3 rpsO Small ribosomal subunit protein uS15 Leifsonia xyli subsp. xyli (strain CTCB07)
A9F8Z6 1.16e-27 99 57 0 87 3 rpsO Small ribosomal subunit protein uS15 Sorangium cellulosum (strain So ce56)
Q0BWM8 1.21e-27 99 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Hyphomonas neptunium (strain ATCC 15444)
Q1WU87 1.22e-27 99 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Ligilactobacillus salivarius (strain UCC118)
Q5WT39 1.26e-27 99 55 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila (strain Lens)
Q5ZRV7 1.26e-27 99 55 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHU4 1.26e-27 99 55 0 88 3 rpsO Small ribosomal subunit protein uS15 Legionella pneumophila (strain Corby)
Q88VD5 1.5e-27 98 52 0 89 3 rpsO Small ribosomal subunit protein uS15 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q82K79 1.72e-27 98 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B4UHG4 1.75e-27 98 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter sp. (strain K)
Q2IQ02 1.75e-27 98 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8JFZ0 1.75e-27 98 53 0 89 3 rpsO Small ribosomal subunit protein uS15 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q039L3 1.81e-27 98 55 0 89 3 rpsO Small ribosomal subunit protein uS15 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17040
Feature type CDS
Gene rpsO
Product 30S ribosomal protein S15
Location 3749248 - 3749517 (strand: 1)
Length 270 (nucleotides) / 89 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1463
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00312 Ribosomal protein S15

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0184 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S15P/S13E

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02956 small subunit ribosomal protein S15 Ribosome -

Protein Sequence

MSLSTEAKAKIVAEFGRDANDTGSSEVQIALLTAEINHLQGHFSEHKKDHHSRRGLLRKVSSRRNLLDYLKRKDVARYTALIERLGLRR

Flanking regions ( +/- flanking 50bp)

TGAATTAGAGATTGGCTATCTGAAAATTTTACTTTTATTGGAGTTTTATTATGTCTCTAAGTACTGAAGCGAAAGCAAAGATCGTTGCTGAATTCGGTCGTGATGCTAACGATACTGGCTCAAGCGAAGTTCAGATCGCACTGCTGACTGCAGAAATCAACCACCTGCAAGGTCACTTTTCAGAGCACAAAAAAGATCACCACAGCCGTCGTGGTCTGCTGCGTAAAGTTTCCAGCCGTCGTAATCTGCTGGACTACCTGAAACGTAAAGATGTAGCTCGTTATACTGCACTGATTGAACGTTTAGGTCTGCGTCGCTAATCAAGTGAGTTTCAGTGAAAAGGGGCCCGTAGGCCCCTTTTCTACTAGAA