Homologs in group_1417

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08435 FBDBKF_08435 96.1 Morganella morganii S1 tsaE tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
EHELCC_13090 EHELCC_13090 96.1 Morganella morganii S2 tsaE tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
NLDBIP_13430 NLDBIP_13430 96.1 Morganella morganii S4 tsaE tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
LHKJJB_13125 LHKJJB_13125 96.1 Morganella morganii S3 tsaE tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
HKOGLL_11905 HKOGLL_11905 96.1 Morganella morganii S5 tsaE tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
PMI_RS16730 PMI_RS16730 65.6 Proteus mirabilis HI4320 tsaE tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE

Distribution of the homologs in the orthogroup group_1417

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1417

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AF69 1.23e-67 204 63 0 152 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Shigella flexneri
P0AF67 1.23e-67 204 63 0 152 1 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Escherichia coli (strain K12)
P0AF68 1.23e-67 204 63 0 152 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Escherichia coli O157:H7
P44492 3.35e-50 160 45 1 151 1 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O05515 2.01e-25 97 37 2 153 1 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Bacillus subtilis (strain 168)
P74415 3.23e-22 89 39 4 139 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4UNJ0 2.46e-19 82 31 2 146 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O52749 2.29e-18 79 34 5 151 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q92JQ4 3.38e-18 79 35 2 123 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q68XZ1 1.08e-16 75 31 2 122 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q1RGZ7 4e-16 73 33 2 121 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Rickettsia bellii (strain RML369-C)
Q9ZED0 4.65e-16 73 31 2 122 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Rickettsia prowazekii (strain Madrid E)
O51204 1.35e-15 72 32 3 126 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O83845 4.59e-15 70 33 2 126 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Treponema pallidum (strain Nichols)
O67011 4.43e-13 65 34 4 134 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Aquifex aeolicus (strain VF5)
O86788 1.04e-12 64 40 3 98 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q49864 3.19e-11 61 41 1 84 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Mycobacterium leprae (strain TN)
P9WFS7 7.21e-07 49 38 1 76 1 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFS6 7.21e-07 49 38 1 76 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67172 7.21e-07 49 38 1 76 3 tsaE tRNA threonylcarbamoyladenosine biosynthesis protein TsaE Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09655
Feature type CDS
Gene tsaE
Product tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE
Location 32992 - 33456 (strand: 1)
Length 465 (nucleotides) / 154 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1417
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02367 Threonylcarbamoyl adenosine biosynthesis protein TsaE

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0802 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06925 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE - -

Protein Sequence

MKERLFTLADEAATVALGRALAQQSQRGFVLHLFGDLGAGKTTFSRGFVQALGHSGHVKSPTYTLVEPYELSPRPVYHFDLYRLSDPEELEFMGIRDYFGKNTVCLVEWPQKGAGFLPDADLELHLRYDGEGREARFAARSPYGEELLDKLAEK

Flanking regions ( +/- flanking 50bp)

CGAAACACGCTCAATTATTTCAATAAAAATAACCTGTGACGAAAAAGAACATGAAAGAACGCCTTTTTACGCTGGCAGATGAAGCTGCCACGGTTGCACTGGGCCGCGCATTGGCGCAACAAAGCCAGCGCGGGTTTGTCCTGCATCTTTTCGGTGATTTGGGCGCCGGTAAAACCACATTCAGCCGCGGTTTTGTTCAGGCTCTGGGTCACTCCGGGCATGTTAAAAGCCCGACATACACACTTGTTGAGCCTTATGAGCTCTCCCCGCGTCCGGTTTATCATTTTGATCTGTACCGCCTGTCTGATCCGGAAGAACTGGAATTTATGGGGATCCGTGACTATTTCGGAAAAAATACAGTTTGTCTGGTGGAGTGGCCACAAAAAGGGGCGGGTTTTCTGCCGGATGCAGATTTGGAATTGCACTTACGGTATGATGGAGAAGGTCGGGAAGCCCGTTTTGCTGCCCGCTCACCCTATGGTGAGGAACTCCTGGATAAGTTAGCGGAGAAATAAGGAATTGCCGAGAATGAATGCATATCTGACACGGAAACCGGGTTTAACCT