Homologs in group_3844

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS14615 PMI_RS14615 28.3 Proteus mirabilis HI4320 - PTS sugar transporter subunit IIB

Distribution of the homologs in the orthogroup group_3844

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3844

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q45399 3.28e-12 60 31 0 96 1 celA PTS system cellobiose-specific EIIB component Geobacillus stearothermophilus
P46318 2.42e-09 53 30 0 97 1 licB Lichenan-specific phosphotransferase enzyme IIB component Bacillus subtilis (strain 168)
O05505 4.87e-09 52 32 0 100 1 gmuB PTS system oligo-beta-mannoside-specific EIIB component Bacillus subtilis (strain 168)
A2RIE6 5.73e-09 52 34 2 105 1 ptcB PTS system galactose-specific EIIB component Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CIF0 6.51e-09 52 34 2 105 1 ptcB PTS system cellobiose-specific EIIB component Lactococcus lactis subsp. lactis (strain IL1403)
P55901 4.27e-08 49 33 1 87 3 celA PTS system cellobiose-specific EIIB component (Fragment) Aeromonas hydrophila
P69795 2.58e-05 42 30 1 92 1 chbB PTS system N,N'-diacetylchitobiose-specific EIIB component Escherichia coli (strain K12)
P69796 2.58e-05 42 30 1 92 3 chbB PTS system N,N'-diacetylchitobiose-specific EIIB component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69830 2.58e-05 42 30 1 92 3 chbB PTS system N,N'-diacetylchitobiose-specific EIIB component Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09145
Feature type CDS
Gene -
Product PTS sugar transporter subunit IIB
Location 1915448 - 1915753 (strand: 1)
Length 306 (nucleotides) / 101 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3844
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF02302 PTS system, Lactose/Cellobiose specific IIB subunit

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1440 Carbohydrate transport and metabolism (G) G Phosphotransferase system cellobiose-specific component IIB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02760 cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205] Starch and sucrose metabolism
Phosphotransferase system (PTS)		 -

Protein Sequence

MKKVVLMCDTGISARMLVSKMQDEAQTRGIDIEITSRSVHDYRECAGEYDLALLAPQIRHRLRECQQSATAAGRPVACIEMDPFWNLDSGAVLNQALELLD

Flanking regions ( +/- flanking 50bp)

GGCATTTTTCTGTAAATTCAGTTTGTTACGGGCAGTTTGGAGATAAGGATATGAAGAAGGTGGTACTGATGTGTGACACCGGTATTTCTGCACGGATGCTGGTCAGTAAAATGCAGGATGAAGCACAAACCAGGGGTATTGATATTGAGATTACCAGCCGCTCTGTTCATGACTACCGTGAATGTGCCGGAGAGTATGATCTCGCCCTGCTCGCCCCGCAAATCCGCCACCGCCTGCGTGAATGTCAGCAGAGCGCCACCGCCGCAGGAAGACCTGTCGCCTGCATTGAGATGGATCCATTCTGGAATCTGGACAGTGGTGCGGTATTAAATCAGGCTCTGGAATTACTGGATTAATCAGTGACACAACAAACAACTGAAACCGATATCATTACACTTATCACCTG