Homologs in group_4133
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P69795 | 4.21e-55 | 169 | 87 | 0 | 93 | 1 | chbB | PTS system N,N'-diacetylchitobiose-specific EIIB component | Escherichia coli (strain K12) |
| P69796 | 4.21e-55 | 169 | 87 | 0 | 93 | 3 | chbB | PTS system N,N'-diacetylchitobiose-specific EIIB component | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| P69830 | 4.21e-55 | 169 | 87 | 0 | 93 | 3 | chbB | PTS system N,N'-diacetylchitobiose-specific EIIB component | Escherichia coli O157:H7 |
| P55901 | 3.6e-46 | 146 | 78 | 0 | 88 | 3 | celA | PTS system cellobiose-specific EIIB component (Fragment) | Aeromonas hydrophila |
| Q45399 | 4.25e-16 | 70 | 45 | 1 | 94 | 1 | celA | PTS system cellobiose-specific EIIB component | Geobacillus stearothermophilus |
| P46318 | 4.57e-16 | 70 | 44 | 1 | 93 | 1 | licB | Lichenan-specific phosphotransferase enzyme IIB component | Bacillus subtilis (strain 168) |
| O05505 | 2.63e-14 | 66 | 44 | 1 | 88 | 1 | gmuB | PTS system oligo-beta-mannoside-specific EIIB component | Bacillus subtilis (strain 168) |
| A2RIE6 | 4.59e-09 | 52 | 39 | 4 | 103 | 1 | ptcB | PTS system galactose-specific EIIB component | Lactococcus lactis subsp. cremoris (strain MG1363) |
| Q9CIF0 | 7.43e-09 | 52 | 38 | 3 | 103 | 1 | ptcB | PTS system cellobiose-specific EIIB component | Lactococcus lactis subsp. lactis (strain IL1403) |
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS14615 |
| Feature type | CDS |
| Gene | - |
| Product | PTS sugar transporter subunit IIB |
| Location | 3239362 - 3239688 (strand: -1) |
| Length | 327 (nucleotides) / 108 (amino acids) |
| In genomic island | - |
| Accession | NC_010554 |
|---|---|
| Length | 4063606 nucleotides |
| Topology | circular |
| Plasmid | False |
| Orthogroup | group_4133 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| PF02302 | PTS system, Lactose/Cellobiose specific IIB subunit |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG1440 | Carbohydrate transport and metabolism (G) | G | Phosphotransferase system cellobiose-specific component IIB |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K02760 | cellobiose PTS system EIIB component [EC:2.7.1.196 2.7.1.205] | Starch and sucrose metabolism Phosphotransferase system (PTS) |
- |
MQKKYIYLFCSAGMSTSLLVTKMRAQAEKYDVPVIIEAFPETLAEQKGQEADVVLLGPQIGWMLADIQKLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKASATTN
GAAAGTAGCATTATCTCTAGGGCAGAGTGTGGCCAATTTGAGAGGGTTTTATGCAAAAGAAATATATTTATCTATTTTGTTCTGCTGGCATGTCAACATCTCTGTTAGTGACAAAAATGCGTGCACAAGCAGAAAAATATGATGTACCCGTTATTATTGAAGCTTTTCCAGAAACATTAGCAGAGCAAAAAGGCCAAGAAGCGGATGTCGTTTTATTGGGGCCACAAATTGGTTGGATGCTCGCTGATATTCAAAAATTATTACCCAATAAACCTGTCGAAGTCATTGATTCATTGTTATATGGGAAAGTGGATGGATTAGGTGTATTAAAAGCAGCAGTAGCCGCCATTAAGAAAGCATCAGCAACAACTAATTAATTTTTTTATTGTTATTTTTATTTATTCCAGTCAAAGAGTGAATTTTTCAG
