Homologs in group_881

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04530 FBDBKF_04530 72.1 Morganella morganii S1 - YeeE/YedE family protein
EHELCC_05820 EHELCC_05820 72.1 Morganella morganii S2 - YeeE/YedE family protein
NLDBIP_06140 NLDBIP_06140 72.1 Morganella morganii S4 - YeeE/YedE family protein
LHKJJB_03020 LHKJJB_03020 72.1 Morganella morganii S3 - YeeE/YedE family protein
HKOGLL_06495 HKOGLL_06495 72.1 Morganella morganii S5 - YeeE/YedE family protein
PMI_RS10355 PMI_RS10355 47.4 Proteus mirabilis HI4320 - membrane protein

Distribution of the homologs in the orthogroup group_881

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_881

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q87AD3 3.59e-23 91 35 3 132 3 PD_1893 Probable transporter PD_1893 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PFB3 1.25e-22 89 35 3 132 2 XF_0765 Probable transporter XF_0765 Xylella fastidiosa (strain 9a5c)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08985
Feature type CDS
Gene -
Product YeeE/YedE family protein
Location 1877962 - 1878384 (strand: -1)
Length 423 (nucleotides) / 140 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_881
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF20398 Family of unknown function (DUF6691)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2391 General function prediction only (R) R Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07112 uncharacterized protein - -

Protein Sequence

MQVIFALISGVLFGLGLLVAGMGNPQKIRAFLDITGNWDPSLFVTMAVAMSISMVAFFIAKRRKTSFCGEPVQLPSNTRIDKPLLTGALLFGIGWGLAGICPGPGILLSGMGNIKGVVFTVSMLTGMYVFHITSRNRMQN

Flanking regions ( +/- flanking 50bp)

TATGGTCAGTGCATTTCTGACGGTATGGTTAATGAAGTAAGGAGGCATTTATGCAGGTTATTTTTGCATTAATCAGCGGTGTATTATTCGGTCTGGGATTATTGGTCGCCGGAATGGGTAATCCGCAAAAAATACGCGCTTTTCTGGATATCACCGGAAATTGGGATCCCTCCTTATTCGTAACGATGGCTGTTGCAATGAGTATCAGTATGGTGGCTTTTTTTATTGCTAAACGCCGTAAAACGTCGTTCTGTGGTGAGCCGGTGCAATTGCCGTCCAATACGCGAATCGATAAACCTCTCCTGACCGGCGCATTATTGTTCGGGATTGGCTGGGGGCTTGCCGGTATTTGTCCGGGACCCGGCATATTATTGTCAGGTATGGGAAATATAAAAGGTGTTGTTTTTACCGTTTCGATGCTTACCGGAATGTATGTATTCCATATAACTTCCCGCAACAGAATGCAGAATTGAAGATATTTTGAACGAAACAAGTTTAGACTGAAAACAATACCGAAAGGTGA