Homologs in group_950

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04530 FBDBKF_04530 48.9 Morganella morganii S1 - YeeE/YedE family protein
EHELCC_05820 EHELCC_05820 48.9 Morganella morganii S2 - YeeE/YedE family protein
NLDBIP_06140 NLDBIP_06140 48.9 Morganella morganii S4 - YeeE/YedE family protein
LHKJJB_03020 LHKJJB_03020 48.9 Morganella morganii S3 - YeeE/YedE family protein
HKOGLL_06495 HKOGLL_06495 48.9 Morganella morganii S5 - YeeE/YedE family protein
F4V73_RS08985 F4V73_RS08985 47.4 Morganella psychrotolerans - YeeE/YedE family protein

Distribution of the homologs in the orthogroup group_950

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_950

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q87AD3 2.27e-27 102 43 1 123 3 PD_1893 Probable transporter PD_1893 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PFB3 4.69e-27 101 43 1 123 2 XF_0765 Probable transporter XF_0765 Xylella fastidiosa (strain 9a5c)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10355
Feature type CDS
Gene -
Product membrane protein
Location 2277088 - 2277501 (strand: -1)
Length 414 (nucleotides) / 137 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_950
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF20398 Family of unknown function (DUF6691)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2391 General function prediction only (R) R Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07112 uncharacterized protein - -

Protein Sequence

MTKLIAFISGLLFSAGLIIGGMSNPQKILAFLDIRGDWDPSLLFIMGAGLIVSAISYQIARHRQQSLLACPLAIPTKTVIDKPLVFGSILFGLGWGLAGICPGPGLVLAGGGFTQGVLFVSAMIVGWLFIGLIRKPQ

Flanking regions ( +/- flanking 50bp)

GGCATTTGTGACTGTGTATATTCAACGCCATGTCATCGGAGGCTAAGATAATGACCAAATTAATTGCTTTTATTAGTGGCCTATTATTTAGTGCTGGATTGATCATCGGTGGTATGAGCAACCCACAAAAGATCTTGGCATTTTTAGATATTCGTGGAGATTGGGATCCGTCATTGTTATTTATTATGGGGGCGGGTCTTATCGTCAGTGCTATTAGTTACCAAATTGCACGTCATCGTCAACAAAGTTTATTAGCCTGTCCTCTGGCCATTCCAACTAAAACAGTGATTGATAAACCTCTCGTCTTCGGCAGTATCTTATTTGGTTTAGGATGGGGGCTTGCGGGTATTTGCCCCGGACCGGGTTTGGTATTAGCGGGGGGTGGTTTTACCCAAGGTGTATTATTTGTGTCAGCTATGATTGTTGGGTGGCTATTTATTGGGTTAATTCGCAAACCACAATAATCATCACTATTTTAATCACACGCGATAAAAAACAACAAACGGACCGCATT