Homologs in group_929

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04350 FBDBKF_04350 97.2 Morganella morganii S1 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
EHELCC_05640 EHELCC_05640 97.2 Morganella morganii S2 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
NLDBIP_05960 NLDBIP_05960 97.2 Morganella morganii S4 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
LHKJJB_02840 LHKJJB_02840 97.2 Morganella morganii S3 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
HKOGLL_06315 HKOGLL_06315 97.2 Morganella morganii S5 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
PMI_RS10215 PMI_RS10215 93.1 Proteus mirabilis HI4320 mraY phospho-N-acetylmuramoyl-pentapeptide- transferase

Distribution of the homologs in the orthogroup group_929

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_929

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F114 0.0 680 93 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Proteus mirabilis (strain HI4320)
A1JJJ0 0.0 659 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N144 0.0 659 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JK84 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EK8 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQ86 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis (strain Pestoides F)
Q1CMN0 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZIF2 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis
B2K4E3 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C211 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM69 0.0 656 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9R127 0.0 655 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis bv. Antiqua (strain Angola)
C6DEU6 0.0 654 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0I0 0.0 651 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9S4 0.0 643 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Serratia proteamaculans (strain 568)
Q2NVV4 0.0 639 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sodalis glossinidius (strain morsitans)
C5B9F3 0.0 635 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Edwardsiella ictaluri (strain 93-146)
Q8ZRU5 0.0 634 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RH61 0.0 634 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2M1 0.0 634 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella enteritidis PT4 (strain P125109)
B5FI69 0.0 634 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella dublin (strain CT_02021853)
Q8Z9H1 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella typhi
B4TXH5 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella schwarzengrund (strain CVM19633)
A9MZL6 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SU47 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella newport (strain SL254)
B4TJ84 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella heidelberg (strain SL476)
Q57TD3 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella choleraesuis (strain SC-B67)
A9MQC5 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7W1 0.0 633 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella agona (strain SL483)
B5BLB9 0.0 632 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi A (strain AKU_12601)
Q5PDC3 0.0 632 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0Q5I3 0.0 632 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi C (strain RKS4594)
B1LG24 0.0 631 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain SMS-3-5 / SECEC)
B7N7W0 0.0 631 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NHJ3 0.0 631 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Y1V0 0.0 630 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Klebsiella pneumoniae (strain 342)
A8ALK9 0.0 630 85 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6T4N0 0.0 629 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4W6J0 0.0 629 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Enterobacter sp. (strain 638)
B2VD87 0.0 624 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MIF2 0.0 622 84 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cronobacter sakazakii (strain ATCC BAA-894)
Q32K05 0.0 614 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella dysenteriae serotype 1 (strain Sd197)
P64257 0.0 614 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MNU6 0.0 614 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O81 (strain ED1a)
B5YZC3 0.0 614 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P64258 0.0 614 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O157:H7
Q3Z5S2 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella sonnei (strain Ss046)
P0A6W4 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella flexneri
Q0T8B0 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella flexneri serotype 5b (strain 8401)
Q326E8 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella boydii serotype 4 (strain Sb227)
B2U292 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWF0 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGA8 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain UTI89 / UPEC)
B6HZ64 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain SE11)
P0A6W3 0.0 613 86 0 360 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain K12)
B1IR91 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TLQ2 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7D2 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O1:K1 / APEC
A7ZW39 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O9:H4 (strain HS)
B1XC64 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain K12 / DH10B)
C4ZRI2 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M130 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O8 (strain IAI1)
B7LFV7 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain 55989 / EAEC)
B7MAL0 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UID7 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHH8 0.0 613 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MNV4 0.0 602 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio vulnificus (strain YJ016)
Q8DEK7 0.0 601 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio vulnificus (strain CMCP6)
Q87SG7 0.0 597 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5E2P7 0.0 597 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MWL2 0.0 597 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio campbellii (strain ATCC BAA-1116)
B5FB38 0.0 596 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliivibrio fischeri (strain MJ11)
B7VJ00 0.0 596 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio atlanticus (strain LGP32)
B6ELH8 0.0 595 79 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliivibrio salmonicida (strain LFI1238)
Q6LMF3 0.0 585 79 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Photobacterium profundum (strain SS9)
B8F3B3 0.0 578 78 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Glaesserella parasuis serovar 5 (strain SH0165)
A3MY87 0.0 572 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BRH4 0.0 571 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZK5 0.0 566 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
P57816 0.0 564 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pasteurella multocida (strain Pm70)
A9KY26 0.0 562 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS195)
A3CZL8 0.0 562 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E695 0.0 562 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS223)
A5UIQ9 0.0 562 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain PittGG)
A3QIM4 0.0 562 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A5UCX1 0.0 561 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain PittEE)
A6WIC8 0.0 561 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS185)
C3LQU9 0.0 560 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPG4 0.0 560 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0TQN4 0.0 560 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella halifaxensis (strain HAW-EB4)
P45062 0.0 560 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5F5N2 0.0 560 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q4QLG1 0.0 560 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain 86-028NP)
B1KKY0 0.0 558 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HZR9 0.0 558 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain MR-7)
Q0HE80 0.0 558 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain MR-4)
A8FQ97 0.0 558 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sediminis (strain HAW-EB3)
A0L1P5 0.0 558 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain ANA-3)
A1REZ3 0.0 555 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain W3-18-1)
A4Y2N3 0.0 555 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8E9P5 0.0 555 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1S2F6 0.0 552 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q07WI2 0.0 551 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella frigidimarina (strain NCIMB 400)
B0US64 0.0 551 77 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Histophilus somni (strain 2336)
Q0I1D6 0.0 551 77 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Histophilus somni (strain 129Pt)
Q47VQ6 0.0 551 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5R0M4 0.0 550 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q65RY3 0.0 548 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VQN6 0.0 548 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q15Q14 0.0 547 73 0 356 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7VP57 0.0 544 75 0 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C4LA22 0.0 543 76 0 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4RWY2 0.0 541 72 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q3IG01 0.0 541 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudoalteromonas translucida (strain TAC 125)
A8H987 0.0 533 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9F1N3 0.0 532 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
B8CNK8 0.0 532 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12SC9 0.0 529 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8D2Z3 0.0 517 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wigglesworthia glossinidia brevipalpis
A1SU16 2.04e-177 499 67 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VYK1 6.08e-172 485 66 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Marinomonas sp. (strain MWYL1)
A4XQS1 1.46e-167 474 66 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas mendocina (strain ymp)
Q88N79 5.17e-166 470 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KFS9 5.17e-166 470 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain GB-1)
A5W8Q3 5.17e-166 470 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I5B5 9.03e-166 470 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas entomophila (strain L48)
Q83F26 1.5e-165 469 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KES2 1.5e-165 469 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain Dugway 5J108-111)
B6J2Q9 1.5e-165 469 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain CbuG_Q212)
B6J5K9 1.5e-165 469 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain CbuK_Q154)
B1J3K9 2.05e-165 469 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain W619)
A9NA35 1.77e-164 466 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain RSA 331 / Henzerling II)
A4VIH5 3.97e-164 466 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Stutzerimonas stutzeri (strain A1501)
Q0VS05 6.29e-164 465 63 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1QVG4 8.93e-164 465 66 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4K6J0 1.22e-162 462 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q604V4 3.86e-161 458 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C1DQ96 8.12e-161 457 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q21MH2 1.36e-160 457 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q4ZNY7 4.05e-160 456 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas syringae pv. syringae (strain B728a)
Q87WY2 4.05e-160 456 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3PCM3 2.36e-159 453 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cellvibrio japonicus (strain Ueda107)
C3KCS7 5.72e-159 452 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas fluorescens (strain SBW25)
Q9HVZ8 6.24e-159 452 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H25 6.24e-159 452 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZJ3 6.24e-159 452 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain LESB58)
A6VB88 6.24e-159 452 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain PA7)
C5BP37 1.18e-157 449 62 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3K741 4.74e-157 447 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas fluorescens (strain Pf0-1)
Q5ZSA2 2.37e-156 446 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IAV9 3.11e-156 446 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Corby)
Q5X1S3 3.11e-156 446 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Paris)
Q5WTI4 6.13e-156 445 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Lens)
Q493Q4 1.29e-155 444 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Blochmanniella pennsylvanica (strain BPEN)
Q48EF5 1.52e-155 444 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5GW39 1.7e-154 441 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZB6 1.7e-154 441 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1U3G1 3.31e-154 441 64 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B2SNZ1 5.07e-154 440 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2S9Y9 1.84e-153 439 63 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hahella chejuensis (strain KCTC 2396)
Q31I62 2.12e-153 438 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8PPB0 3.05e-153 438 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas axonopodis pv. citri (strain 306)
Q8PCK2 5.56e-153 437 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVA7 5.56e-153 437 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas campestris pv. campestris (strain B100)
Q4UQW8 5.56e-153 437 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas campestris pv. campestris (strain 8004)
Q3BXF4 1.73e-152 436 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0A6J9 3.29e-152 435 63 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3J786 1.31e-151 434 62 1 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1GYZ8 5.88e-149 427 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B5EBP8 2.04e-147 423 58 1 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6DZK3 2.96e-146 420 57 1 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacter sp. (strain M21)
B8GMM6 5.08e-146 420 61 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q47AA1 5.27e-145 417 60 2 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Dechloromonas aromatica (strain RCB)
Q9PF83 5.33e-145 417 59 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain 9a5c)
Q3SMH6 9.72e-145 416 59 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thiobacillus denitrificans (strain ATCC 25259)
Q87AF7 2.74e-144 415 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U4Z9 2.74e-144 415 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain M12)
B2I9B5 2.74e-144 415 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain M23)
P57314 9.67e-144 414 54 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D917 1.2e-143 414 54 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q3A2G3 1.67e-143 413 58 2 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C1D5M0 1.9e-143 413 59 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Laribacter hongkongensis (strain HLHK9)
Q82VS6 1.94e-143 413 57 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1WYU6 2.09e-143 413 62 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Halorhodospira halophila (strain DSM 244 / SL1)
B8D7C2 4.41e-143 412 54 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q0AJD8 4.55e-142 410 57 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2Y635 1.23e-141 409 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3E3Y5 1.77e-141 408 57 1 344 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A1K3U3 5.62e-141 407 60 2 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azoarcus sp. (strain BH72)
B0V8P2 6.73e-141 407 54 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain AYE)
B0VPG4 6.73e-141 407 54 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain SDF)
B2I0K2 6.73e-141 407 54 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain ACICU)
B7IAW6 6.73e-141 407 54 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain AB0057)
A1AU64 1.11e-140 406 58 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q6F7D6 1.28e-140 406 54 3 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1AVY0 1.45e-140 406 53 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ruthia magnifica subsp. Calyptogena magnifica
A5EY06 5.32e-139 402 55 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Dichelobacter nodosus (strain VCS1703A)
Q1Q851 1.86e-138 401 54 3 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5WBQ6 2.34e-138 400 54 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychrobacter sp. (strain PRwf-1)
Q4FQ10 3.18e-138 400 54 2 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q2LR51 6.13e-138 399 56 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Syntrophus aciditrophicus (strain SB)
Q748D3 8.13e-138 399 59 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q7NPZ6 1.11e-137 399 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5P6Z3 6.1e-137 397 58 2 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6AJ51 3.12e-136 395 56 4 357 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q2RVU1 1.22e-135 393 53 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5CXA6 9.43e-135 391 50 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A1KVL7 1.63e-134 390 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K0Y6 1.63e-134 390 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JSZ3 2.57e-134 390 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A6T2G1 3.9e-134 390 55 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Janthinobacterium sp. (strain Marseille)
A4IZH0 7.06e-134 389 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHK4 8.14e-134 389 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14J06 8.14e-134 389 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. tularensis (strain FSC 198)
A0Q5C1 1.09e-133 389 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. novicida (strain U112)
Q39YM2 1.21e-133 388 58 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B8FBS1 1.91e-133 388 54 5 363 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfatibacillum aliphaticivorans
B2SDR9 2.56e-133 387 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. mediasiatica (strain FSC147)
B5ELC6 4.25e-133 387 55 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3V5 4.25e-133 387 55 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0BKM7 6e-133 387 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1Z8 6e-133 387 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. holarctica (strain LVS)
A7NDX5 6e-133 387 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A9M2H7 1.64e-132 385 54 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup C (strain 053442)
A4G8U1 2.25e-132 386 55 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Herminiimonas arsenicoxydans
B4RQC9 5.06e-132 384 54 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F6L4 5.06e-132 384 54 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
C0Q8P0 2.16e-131 382 53 3 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B0TZ73 2.48e-131 382 52 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B6IRG5 4.34e-131 382 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodospirillum centenum (strain ATCC 51521 / SW)
B2UCY0 8.6e-131 382 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ralstonia pickettii (strain 12J)
A8ZXW6 1.26e-130 380 55 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q07PT6 2.93e-130 380 52 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain BisA53)
A4YZK6 3.02e-130 380 51 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bradyrhizobium sp. (strain ORS 278)
Q313Q6 3.05e-130 380 54 4 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8XVI4 1.24e-129 379 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5EPK7 1.32e-129 378 50 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4SV71 2.58e-129 378 53 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A5FUK7 6.16e-129 376 52 3 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidiphilium cryptum (strain JF-5)
B1XT06 8.11e-129 377 53 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q216E1 9.72e-129 376 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain BisB18)
A0L5N4 1.41e-128 375 55 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C4XK72 3.47e-128 374 53 4 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q2IYL1 6.42e-128 374 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain HaA2)
A9I4U2 1.07e-127 374 54 4 390 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2W0H6 1.32e-127 373 55 2 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P59436 1.46e-127 372 54 0 336 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q89FU4 1.48e-127 373 51 1 350 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A7HVU4 8.7e-127 371 54 2 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A6WZQ3 8.88e-127 371 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q133W8 1.27e-126 370 52 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain BisB5)
Q2SZI6 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QJ4 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain K96243)
A3NDW7 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain 668)
Q3JND5 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain 1710b)
A1V0S1 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain SAVP1)
Q62GS4 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain ATCC 23344)
A2S5U8 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain NCTC 10229)
A3MR60 1.69e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain NCTC 10247)
A3NZL8 1.75e-126 371 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain 1106a)
A4WQD0 2.17e-126 370 54 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q7VUQ0 2.28e-126 370 55 3 375 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WFR9 2.28e-126 370 55 3 375 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B6JCF5 2.95e-126 370 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q7W4B1 5.27e-126 369 55 3 375 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A5VRI0 8.3e-126 368 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q5LU74 1.13e-125 368 52 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2K6B8 1.36e-125 368 51 5 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q3J4M8 1.88e-125 367 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PHS2 1.88e-125 367 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A9AJ19 2.05e-125 369 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia multivorans (strain ATCC 17616 / 249)
B3PTW3 2.35e-125 367 51 5 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium etli (strain CIAT 652)
A4JB91 2.52e-125 368 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2JHG3 2.58e-125 368 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q13TY9 2.61e-125 368 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paraburkholderia xenovorans (strain LB400)
B2SYX9 3.39e-125 368 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q3STT1 3.41e-125 367 52 2 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1AZK6 6.81e-125 366 52 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paracoccus denitrificans (strain Pd 1222)
Q1BZG6 1.04e-124 367 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia orbicola (strain AU 1054)
B1JV75 1.04e-124 367 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia orbicola (strain MC0-3)
Q39JX3 1.04e-124 367 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E6J5 1.04e-124 367 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K483 1.04e-124 367 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia cenocepacia (strain HI2424)
P64256 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella suis biovar 1 (strain 1330)
B0CHM3 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella suis (strain ATCC 23445 / NCTC 10510)
P64255 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE73 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M693 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57C75 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella abortus biovar 1 (strain 9-941)
Q2YM68 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella abortus (strain 2308)
B2S6Q7 1.2e-124 365 50 2 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella abortus (strain S19)
Q0BV22 1.31e-124 365 51 2 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B5ZWJ7 1.32e-124 365 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1ME30 1.36e-124 365 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1QNU6 1.5e-124 365 52 2 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B9KNJ3 1.58e-124 365 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A1TKC8 1.66e-124 366 54 4 374 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paracidovorax citrulli (strain AAC00-1)
Q0BIK4 2.26e-124 366 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YSS1 2.26e-124 366 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia ambifaria (strain MC40-6)
Q21SW6 4.79e-124 365 51 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9BUK3 6.71e-124 365 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q46WZ1 1.19e-123 364 50 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C3MEN2 1.37e-123 363 51 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1RI79 1.59e-123 362 50 5 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia bellii (strain RML369-C)
A1VBE5 3.4e-123 362 55 4 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitratidesulfovibrio vulgaris (strain DP4)
Q728U5 3.4e-123 362 55 4 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q1IKG7 5.71e-123 362 49 4 379 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Koribacter versatilis (strain Ellin345)
A8GVM4 9.41e-123 360 50 5 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia bellii (strain OSU 85-389)
Q52952 9.76e-123 361 50 3 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium meliloti (strain 1021)
Q6N408 1.3e-122 360 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1WC09 1.33e-122 361 53 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidovorax sp. (strain JS42)
B9MFR5 1.33e-122 361 53 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidovorax ebreus (strain TPSY)
B9JH54 1.48e-122 360 50 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A6UB88 1.56e-122 360 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sinorhizobium medicae (strain WSM419)
B3QFN4 2.02e-122 360 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain TIE-1)
Q1GF14 3.67e-122 359 51 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ruegeria sp. (strain TM1040)
Q1LIM3 1.05e-121 359 51 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A7IGE9 1.57e-121 357 52 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q0K6M1 2.2e-121 358 50 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0AMW4 2.99e-121 357 52 5 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Maricaulis maris (strain MCS10)
A5VDC9 3.73e-121 356 52 4 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B3R6W2 4.57e-121 357 50 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q2NCZ3 5.71e-121 356 51 3 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Erythrobacter litoralis (strain HTCC2594)
Q9AKD8 7.77e-121 356 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B5YFT8 1.15e-120 355 50 1 336 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q6MIF7 2.26e-120 354 51 3 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q12EL8 3.91e-120 355 51 5 386 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q98KB0 4.2e-120 354 49 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C6BYG9 5.83e-120 353 51 3 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q11GS2 5.96e-120 353 49 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chelativorans sp. (strain BNC1)
C5CNF1 6.66e-120 355 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Variovorax paradoxus (strain S110)
B1XYR0 1.1e-119 354 51 3 387 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B9JY57 1.28e-119 353 49 4 369 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1GRX6 2.98e-119 352 51 4 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q2G998 3.11e-119 351 52 5 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A8GP69 1.64e-118 350 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia akari (strain Hartford)
Q4FPK2 2.15e-118 350 48 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelagibacter ubique (strain HTCC1062)
A1VST9 5.3e-118 350 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polaromonas naphthalenivorans (strain CJ2)
C1F461 6.36e-118 349 49 4 377 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B2IGF7 7.04e-118 348 52 4 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C4K1S5 1.03e-117 348 48 4 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia peacockii (strain Rustic)
B0UFH5 1.31e-117 347 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacterium sp. (strain 4-46)
Q7VQJ0 1.71e-117 347 48 2 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Blochmanniella floridana
A2SCY2 2.54e-117 348 51 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
P56834 2.57e-117 347 51 3 337 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9ZCW0 5.46e-117 346 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia prowazekii (strain Madrid E)
Q92H61 1.33e-116 345 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9AKP2 2.46e-116 344 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia montanensis
A8GSX5 4.28e-116 343 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii (strain Sheila Smith)
B0BYF0 4.28e-116 343 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii (strain Iowa)
Q9AKI9 4.28e-116 343 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii
A8HZ57 6.13e-116 343 50 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A8F278 6.91e-116 343 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia massiliae (strain Mtu5)
C3PP35 9.37e-116 343 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia africae (strain ESF-5)
B7KU72 1.28e-115 342 52 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A9IWA8 1.31e-115 342 52 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q5FUJ8 3.46e-115 342 50 2 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gluconobacter oxydans (strain 621H)
B1LXZ8 3.66e-115 341 51 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A8LSB0 4.7e-115 341 49 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A9H0I1 5.18e-115 341 50 3 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B8H097 6.89e-115 341 49 5 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caulobacter vibrioides (strain NA1000 / CB15N)
Q4UMI7 7.18e-115 340 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B8IMW7 9.33e-115 340 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A1WRK8 1.4e-114 341 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Verminephrobacter eiseniae (strain EF01-2)
B1Z8W9 2.09e-114 339 51 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q6G121 5.93e-114 338 51 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella quintana (strain Toulouse)
B8ETL9 1.03e-113 338 51 4 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q8UDM5 1.11e-113 338 48 3 354 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Agrobacterium fabrum (strain C58 / ATCC 33970)
B8IZT8 3.56e-112 333 51 4 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B0T834 4.83e-112 334 48 4 364 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caulobacter sp. (strain K31)
C0R1X0 1.43e-111 333 46 2 369 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q01Q45 1.63e-111 333 48 4 375 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Solibacter usitatus (strain Ellin6076)
A8EY83 1.8e-111 332 48 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia canadensis (strain McKiel)
Q6G2Q2 4.13e-110 328 51 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q3B126 6.39e-110 328 47 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B4S6R2 8.21e-110 328 47 6 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B1GZI2 1.76e-109 327 47 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Endomicrobium trichonymphae
A1UTC8 4.89e-109 325 50 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B3EQC1 2.29e-108 324 46 5 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeobacteroides (strain BS1)
A9FI43 7.33e-107 321 50 7 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sorangium cellulosum (strain So ce56)
B3QLW7 1.08e-106 320 45 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A1BJY1 1.1e-106 320 45 4 369 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0SRS0 4.46e-106 318 46 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S986 4.46e-106 318 46 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B3QWT4 1.48e-105 317 48 6 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
O66465 2.26e-105 316 48 4 363 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aquifex aeolicus (strain VF5)
Q28NN1 3.17e-105 316 51 3 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Jannaschia sp. (strain CCS1)
Q1MPC2 4.21e-105 315 51 4 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lawsonia intracellularis (strain PHE/MN1-00)
B4RFS3 2.14e-104 314 47 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Phenylobacterium zucineum (strain HLK1)
B4U9Q9 4.26e-104 313 46 5 364 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hydrogenobaculum sp. (strain Y04AAS1)
B4SHE7 4.34e-104 313 47 3 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q8KGD1 4.07e-103 311 43 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A4SH05 5.64e-103 310 46 6 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B3EIL1 2.01e-102 309 45 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q3ANV6 2.94e-102 309 45 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium chlorochromatii (strain CaD3)
B4UER8 6.65e-102 308 47 5 371 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter sp. (strain K)
Q2IG26 6.65e-102 308 47 5 371 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J8E5 6.65e-102 308 47 5 371 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q661W1 1.13e-100 304 41 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B2S014 1.51e-100 304 43 2 341 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia hermsii (strain HS1 / DAH)
Q8F4J3 5.12e-100 303 45 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72R82 5.12e-100 303 45 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6MBS3 7.99e-100 304 43 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Protochlamydia amoebophila (strain UWE25)
B5RLC9 1.16e-99 301 42 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia duttonii (strain Ly)
B5RRC2 1.29e-99 301 42 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia recurrentis (strain A1)
A1QZ99 2.53e-99 301 42 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia turicatae (strain 91E135)
Q0SNK7 9.93e-99 299 40 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella afzelii (strain PKo)
A8EW04 2.26e-98 298 43 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliarcobacter butzleri (strain RM4018)
C1A8A7 6.61e-98 298 45 6 382 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B7J1N1 1.33e-97 296 40 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella burgdorferi (strain ZS7)
Q44776 1.33e-97 296 40 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A6Q1R7 2.31e-97 296 43 3 355 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitratiruptor sp. (strain SB155-2)
B3DVW4 3.2e-97 296 44 4 364 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylacidiphilum infernorum (isolate V4)
Q8RDQ0 3.66e-97 295 44 5 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q11RH2 1.88e-96 295 39 4 403 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q7M7X0 4.99e-95 290 42 1 353 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9KEZ5 6.27e-95 290 42 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q30Q39 1.18e-94 289 42 4 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q1D0S7 1.79e-94 290 45 5 374 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Myxococcus xanthus (strain DK1622)
A8Z6N6 2.16e-94 288 43 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter concisus (strain 13826)
O25235 2.33e-94 288 45 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain ATCC 700392 / 26695)
A7GWQ7 2.51e-94 288 43 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter curvus (strain 525.92)
Q9ZLY1 3.47e-93 285 44 3 344 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain J99 / ATCC 700824)
B9L7V6 6.52e-93 284 42 5 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q17XN0 1.45e-92 283 45 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter acinonychis (strain Sheeba)
Q04Y84 3.1e-92 283 45 3 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04V92 3.1e-92 283 45 3 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B6JL77 8.14e-92 281 45 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain P12)
Q1CU36 1.02e-91 281 45 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain HPAG1)
A0Q060 1.52e-91 280 43 3 331 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium novyi (strain NT)
Q0BXT9 3.41e-91 281 43 4 396 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hyphomonas neptunium (strain ATCC 15444)
A7HH64 3.76e-91 281 50 5 366 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter sp. (strain Fw109-5)
Q2S531 4.48e-91 281 42 7 386 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salinibacter ruber (strain DSM 13855 / M31)
B3CVD3 5.24e-91 280 42 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Orientia tsutsugamushi (strain Ikeda)
C5D8M1 7.32e-91 278 46 4 331 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus sp. (strain WCH70)
A8FKM0 1.77e-90 278 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B2UTZ3 1.81e-90 278 45 4 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain Shi470)
Q5HW33 4.45e-90 277 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni (strain RM1221)
A1VYF0 4.7e-90 277 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A0RQL9 6.49e-90 276 41 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter fetus subsp. fetus (strain 82-40)
B3ER47 1.19e-89 278 36 6 404 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Amoebophilus asiaticus (strain 5a2)
Q9PI72 1.25e-89 276 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A9VU75 1.75e-88 272 46 6 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus mycoides (strain KBAB4)
A8MH33 1.98e-87 270 44 5 333 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alkaliphilus oremlandii (strain OhILAs)
Q81WC8 5.29e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis
C3L712 5.29e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P683 5.29e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis (strain A0248)
A5FIY0 6.04e-87 271 36 7 413 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q6HEQ1 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636B3 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ZK / E33L)
B9IVZ0 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain Q1)
B7HM34 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain AH187)
C1EPS7 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain 03BB102)
B7IUS3 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain G9842)
Q732F5 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JK01 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain AH820)
A0RHT4 9.7e-87 268 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus thuringiensis (strain Al Hakam)
B7GGI5 1.92e-86 267 46 4 325 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A0M530 2.23e-86 270 38 5 410 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q5L0X8 3.45e-86 266 45 6 332 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus kaustophilus (strain HTA426)
Q819Q1 3.72e-86 266 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H6P9 3.72e-86 266 46 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain B4264)
A4IM06 4.83e-86 266 45 5 332 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus thermodenitrificans (strain NG80-2)
B1ZU32 3.73e-85 265 42 9 374 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A6H198 4.09e-85 266 37 5 409 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A6QCC3 1.35e-83 260 42 4 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sulfurovum sp. (strain NBC37-1)
A6LEU6 1.53e-83 263 36 6 419 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A5N7E7 3.28e-83 258 41 3 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E0W0 3.28e-83 258 41 3 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium kluyveri (strain NBRC 12016)
Q03521 3.32e-83 258 46 6 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus subtilis (strain 168)
A7I3M7 1.11e-82 258 42 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A7GRN9 1.18e-82 257 45 6 325 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q7VGZ9 4.47e-82 257 41 5 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A7Z4E2 5.49e-82 255 45 6 338 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A3DE29 7.6e-82 255 41 5 329 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8R9G3 1.18e-81 254 40 4 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9K9S6 3.1e-81 253 46 5 332 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B6YS29 1.04e-80 255 37 6 411 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q65JY3 1.14e-80 252 46 8 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2V4V5 1.43e-80 252 41 4 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium botulinum (strain Alaska E43 / Type E3)
B2TS25 2.37e-80 251 41 4 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium botulinum (strain Eklund 17B / Type B)
Q5WFG7 6.69e-80 250 46 3 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shouchella clausii (strain KSM-K16)
Q2YXE0 2.1e-79 249 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B9DPR2 4.15e-79 248 44 7 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus carnosus (strain TM300)
Q2RK82 6.71e-79 247 43 4 336 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q7MWM6 7.8e-79 250 36 7 419 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIE8 1.19e-78 250 36 7 419 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8NX36 1.5e-78 246 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MW2)
Q6GA30 1.5e-78 246 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MSSA476)
A4J2A8 4.56e-78 246 47 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P0C1R8 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus
A8Z3M3 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GHQ3 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MRSA252)
P68783 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain N315)
P68782 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG82 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Newman)
Q5HGP9 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain COL)
A5IS68 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain JH9)
Q2FZ93 5.32e-78 245 43 5 327 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHQ5 5.32e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain USA300)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08795
Feature type CDS
Gene mraY
Product phospho-N-acetylmuramoyl-pentapeptide- transferase
Location 1820249 - 1821331 (strand: -1)
Length 1083 (nucleotides) / 360 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_929
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00953 Glycosyl transferase family 4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0472 Cell wall/membrane/envelope biogenesis (M) M UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01000 phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13] Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
-

Protein Sequence

MLTWLAEYLVQFHTAFNVFSYLTFRAIVGLLTSLIIALWMGPHVIAYLQRMQIGQVVRSEGPESHFSKRGTPTMGGMMILFSIVISVLLWARLDNPYVWCVLLVLIGYGVVGFVDDYRKVVRKDTKGLIARWKYFWQSVLALAVAFSMYAIGKDTAATQLVVPFFKDVMPQLGLLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFAHYLSIPYLPYAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIMGGVFVAETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR

Flanking regions ( +/- flanking 50bp)

CGCAGCTCCGCAATGGAAGAAGTTGTGCACGCCTTGCAGGAGACTATCCCATGCTGACCTGGCTGGCCGAATATCTGGTGCAGTTCCATACTGCGTTTAACGTCTTTTCGTATCTGACGTTCCGCGCCATTGTTGGTCTGCTGACCTCACTGATTATTGCATTATGGATGGGACCGCATGTGATTGCGTATCTTCAGAGAATGCAGATTGGTCAGGTTGTCCGCAGCGAAGGACCTGAATCGCACTTCAGTAAGCGTGGCACGCCGACGATGGGCGGCATGATGATCCTCTTCTCTATCGTTATTTCAGTGCTGCTGTGGGCGCGGCTGGATAACCCGTATGTCTGGTGTGTGCTGCTGGTACTCATCGGCTACGGCGTTGTCGGTTTTGTGGATGATTACCGCAAAGTGGTGCGCAAAGACACCAAAGGGCTGATTGCCCGCTGGAAATATTTCTGGCAGTCCGTGCTGGCGCTGGCGGTTGCATTCAGTATGTATGCCATCGGTAAAGACACGGCAGCCACACAGTTAGTTGTGCCGTTCTTTAAAGATGTGATGCCGCAGCTGGGTCTGCTTTATATCCTGCTGGCTTACTTTGTGATTGTCGGCACCAGCAACGCGGTGAATTTAACTGATGGTCTGGATGGTCTGGCAATTATGCCGACGGTCTTTGTTGCCGCCGGATTTGCACTGGTGGCCTGGGCGACCGGTAACGTAAATTTTGCACATTATCTGAGCATTCCGTATCTGCCGTATGCCGGGGAATTGGTGATTGTCTGCACGGCAATTGTCGGGGCGGGGCTTGGTTTCCTCTGGTTTAACACCTATCCGGCGCAGGTTTTCATGGGTGATGTCGGCTCGCTGGCACTCGGAGGGGCGCTCGGAACGATTGCTGTACTGCTGCGTCAGGAATTCCTGCTGCTGATTATGGGTGGCGTATTTGTGGCAGAAACACTGTCGGTGATTTTACAGGTTGGCTCCTTCAAGTTACGCGGTCAGCGTATCTTCCGGATGGCACCTATTCATCATCATTATGAATTAAAAGGCTGGCCTGAACCGCGGGTGATTGTCCGTTTCTGGATTATCTCTCTGATGTTAGTGCTTATTGGTCTGGCGACACTCAAGGTACGTTAATCATGACGAATTATCAGGGGAAAGACATTGTAATTGTCGGGCTCGGTTTA