Homologs in group_860

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04350 FBDBKF_04350 100.0 Morganella morganii S1 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
NLDBIP_05960 NLDBIP_05960 100.0 Morganella morganii S4 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
LHKJJB_02840 LHKJJB_02840 100.0 Morganella morganii S3 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
HKOGLL_06315 HKOGLL_06315 100.0 Morganella morganii S5 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase
F4V73_RS08795 F4V73_RS08795 97.2 Morganella psychrotolerans mraY phospho-N-acetylmuramoyl-pentapeptide- transferase
PMI_RS10215 PMI_RS10215 94.4 Proteus mirabilis HI4320 mraY phospho-N-acetylmuramoyl-pentapeptide- transferase

Distribution of the homologs in the orthogroup group_860

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_860

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F114 0.0 688 94 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Proteus mirabilis (strain HI4320)
Q7N144 0.0 671 91 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JJJ0 0.0 668 90 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JK84 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EK8 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQ86 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis (strain Pestoides F)
Q1CMN0 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZIF2 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis
B2K4E3 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C211 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM69 0.0 661 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DEU6 0.0 660 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A9R127 0.0 660 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Yersinia pestis bv. Antiqua (strain Angola)
Q6D0I0 0.0 658 89 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9S4 0.0 653 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Serratia proteamaculans (strain 568)
Q2NVV4 0.0 644 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sodalis glossinidius (strain morsitans)
C5B9F3 0.0 644 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Edwardsiella ictaluri (strain 93-146)
Q8ZRU5 0.0 641 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RH61 0.0 641 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2M1 0.0 641 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella enteritidis PT4 (strain P125109)
B5FI69 0.0 641 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella dublin (strain CT_02021853)
Q8Z9H1 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella typhi
B4TXH5 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella schwarzengrund (strain CVM19633)
A9MZL6 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SU47 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella newport (strain SL254)
B4TJ84 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella heidelberg (strain SL476)
Q57TD3 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella choleraesuis (strain SC-B67)
A9MQC5 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7W1 0.0 640 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella agona (strain SL483)
B5Y1V0 0.0 639 87 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Klebsiella pneumoniae (strain 342)
C0Q5I3 0.0 639 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi C (strain RKS4594)
B1LG24 0.0 638 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain SMS-3-5 / SECEC)
B7N7W0 0.0 638 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NHJ3 0.0 638 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A6T4N0 0.0 637 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8ALK9 0.0 637 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BLB9 0.0 636 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi A (strain AKU_12601)
Q5PDC3 0.0 636 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A4W6J0 0.0 636 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Enterobacter sp. (strain 638)
B2VD87 0.0 634 88 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MIF2 0.0 632 85 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cronobacter sakazakii (strain ATCC BAA-894)
Q32K05 0.0 622 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella dysenteriae serotype 1 (strain Sd197)
P64257 0.0 622 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MNU6 0.0 622 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O81 (strain ED1a)
B5YZC3 0.0 622 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P64258 0.0 622 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O157:H7
Q3Z5S2 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella sonnei (strain Ss046)
P0A6W4 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella flexneri
Q0T8B0 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella flexneri serotype 5b (strain 8401)
Q326E8 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella boydii serotype 4 (strain Sb227)
B2U292 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWF0 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RGA8 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain UTI89 / UPEC)
B6HZ64 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain SE11)
P0A6W3 0.0 620 86 0 360 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain K12)
B1IR91 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TLQ2 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7D2 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O1:K1 / APEC
A7ZW39 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O9:H4 (strain HS)
B1XC64 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain K12 / DH10B)
C4ZRI2 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M130 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O8 (strain IAI1)
B7LFV7 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli (strain 55989 / EAEC)
B7MAL0 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UID7 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHH8 0.0 620 86 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MNV4 0.0 607 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio vulnificus (strain YJ016)
Q8DEK7 0.0 606 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio vulnificus (strain CMCP6)
Q87SG7 0.0 602 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWL2 0.0 602 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio campbellii (strain ATCC BAA-1116)
B6ELH8 0.0 599 79 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliivibrio salmonicida (strain LFI1238)
B5FB38 0.0 598 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliivibrio fischeri (strain MJ11)
Q5E2P7 0.0 598 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B7VJ00 0.0 593 80 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio atlanticus (strain LGP32)
Q6LMF3 0.0 585 78 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Photobacterium profundum (strain SS9)
B8F3B3 0.0 579 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Glaesserella parasuis serovar 5 (strain SH0165)
A3MY87 0.0 578 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BRH4 0.0 577 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZK5 0.0 571 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A9KY26 0.0 566 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS195)
A3CZL8 0.0 566 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E695 0.0 566 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS223)
A3QIM4 0.0 566 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P57816 0.0 566 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pasteurella multocida (strain Pm70)
B0TQN4 0.0 565 77 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella halifaxensis (strain HAW-EB4)
A6WIC8 0.0 565 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella baltica (strain OS185)
A5UIQ9 0.0 565 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain PittGG)
A5UCX1 0.0 565 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain PittEE)
P45062 0.0 563 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLG1 0.0 563 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus influenzae (strain 86-028NP)
C3LQU9 0.0 563 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPG4 0.0 563 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B1KKY0 0.0 563 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella woodyi (strain ATCC 51908 / MS32)
A5F5N2 0.0 563 81 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A8FQ97 0.0 563 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sediminis (strain HAW-EB3)
Q0HZR9 0.0 561 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain MR-7)
Q0HE80 0.0 561 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain MR-4)
A0L1P5 0.0 561 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain ANA-3)
A1REZ3 0.0 560 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella sp. (strain W3-18-1)
A4Y2N3 0.0 560 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8E9P5 0.0 559 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0US64 0.0 557 77 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Histophilus somni (strain 2336)
Q0I1D6 0.0 557 77 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Histophilus somni (strain 129Pt)
A1S2F6 0.0 555 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q07WI2 0.0 553 75 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella frigidimarina (strain NCIMB 400)
Q47VQ6 0.0 551 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5R0M4 0.0 549 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7VP57 0.0 548 75 0 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65RY3 0.0 547 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VQN6 0.0 547 74 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C4LA22 0.0 545 76 0 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q15Q14 0.0 544 74 0 356 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3IG01 0.0 542 73 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudoalteromonas translucida (strain TAC 125)
B4RWY2 0.0 539 72 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8H987 0.0 538 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q9F1N3 0.0 537 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
B8CNK8 0.0 536 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12SC9 0.0 531 76 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8D2Z3 0.0 514 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wigglesworthia glossinidia brevipalpis
A1SU16 5.66e-178 501 67 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A6VYK1 2.55e-171 484 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Marinomonas sp. (strain MWYL1)
A4XQS1 8.93e-168 475 66 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas mendocina (strain ymp)
B1J3K9 7.96e-167 473 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain W619)
Q88N79 9.59e-167 472 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KFS9 9.59e-167 472 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain GB-1)
A5W8Q3 9.59e-167 472 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I5B5 6.22e-166 470 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas entomophila (strain L48)
Q1QVG4 6.54e-165 468 66 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A4VIH5 2.38e-164 466 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Stutzerimonas stutzeri (strain A1501)
Q83F26 3.01e-163 463 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KES2 3.01e-163 463 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain Dugway 5J108-111)
B6J2Q9 3.01e-163 463 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain CbuG_Q212)
B6J5K9 3.01e-163 463 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain CbuK_Q154)
Q4K6J0 3.74e-163 463 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0VS05 4.81e-163 463 62 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A9NA35 4.79e-162 460 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q21MH2 4.89e-162 460 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C1DQ96 4.55e-161 458 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q604V4 5.6e-161 457 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q4ZNY7 5.98e-161 457 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas syringae pv. syringae (strain B728a)
Q87WY2 5.98e-161 457 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HVZ8 1.21e-159 454 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H25 1.21e-159 454 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZJ3 1.21e-159 454 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain LESB58)
A6VB88 1.21e-159 454 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas aeruginosa (strain PA7)
C3KCS7 3.65e-159 453 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas fluorescens (strain SBW25)
B3PCM3 6.45e-159 452 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cellvibrio japonicus (strain Ueda107)
C5BP37 7.11e-159 452 61 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3K741 1.39e-157 449 65 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas fluorescens (strain Pf0-1)
Q5ZSA2 2.26e-157 449 62 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IAV9 4.12e-157 448 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Corby)
Q5X1S3 4.12e-157 448 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Paris)
Q5WTI4 1.4e-156 446 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Legionella pneumophila (strain Lens)
Q48EF5 2.31e-156 446 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1U3G1 2.88e-156 446 64 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2S9Y9 6.05e-156 445 64 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hahella chejuensis (strain KCTC 2396)
Q493Q4 2.33e-155 443 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Blochmanniella pennsylvanica (strain BPEN)
Q5GW39 2.03e-154 441 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZB6 2.03e-154 441 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SNZ1 4.45e-154 440 61 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q8PPB0 4.23e-153 437 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas axonopodis pv. citri (strain 306)
Q8PCK2 5.21e-153 437 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVA7 5.21e-153 437 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas campestris pv. campestris (strain B100)
Q4UQW8 5.21e-153 437 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas campestris pv. campestris (strain 8004)
Q31I62 6.55e-153 437 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3BXF4 1.04e-152 437 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0A6J9 4.19e-152 435 63 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3J786 2.5e-151 433 62 1 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1GYZ8 7.11e-148 424 60 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B8GMM6 4.4e-147 422 61 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B5EBP8 8.53e-147 422 58 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q47AA1 1.95e-146 421 60 2 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Dechloromonas aromatica (strain RCB)
C6DZK3 8.1e-146 419 57 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacter sp. (strain M21)
P57314 9.52e-146 419 55 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D917 1.44e-145 418 55 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q3SMH6 1.99e-145 418 59 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thiobacillus denitrificans (strain ATCC 25259)
B8D7C2 2.41e-145 418 55 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q9PF83 1.13e-144 416 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain 9a5c)
Q87AF7 4.9e-144 415 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U4Z9 4.9e-144 415 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain M12)
B2I9B5 4.9e-144 415 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xylella fastidiosa (strain M23)
C1D5M0 9.64e-144 414 58 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Laribacter hongkongensis (strain HLHK9)
Q82VS6 9.85e-144 414 58 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3A2G3 2.1e-143 413 58 2 355 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q6F7D6 4.29e-143 413 54 3 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2Y635 5.97e-143 412 59 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1WYU6 1.65e-142 411 61 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Halorhodospira halophila (strain DSM 244 / SL1)
B3E3Y5 4.02e-142 410 58 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B0V8P2 3.99e-141 408 53 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain AYE)
B0VPG4 3.99e-141 408 53 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain SDF)
B2I0K2 3.99e-141 408 53 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain ACICU)
B7IAW6 3.99e-141 408 53 3 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acinetobacter baumannii (strain AB0057)
Q0AJD8 4.51e-141 407 57 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1K3U3 7.89e-141 407 60 4 363 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azoarcus sp. (strain BH72)
A1AVY0 7.63e-140 404 52 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ruthia magnifica subsp. Calyptogena magnifica
A5EY06 8.41e-140 404 56 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Dichelobacter nodosus (strain VCS1703A)
Q4FQ10 9.66e-140 404 54 2 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1AU64 1.33e-139 403 57 1 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q1Q851 1.09e-138 402 54 2 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5WBQ6 2.98e-138 400 53 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Psychrobacter sp. (strain PRwf-1)
Q6AJ51 7.06e-138 399 56 4 357 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q2LR51 1.36e-137 398 55 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Syntrophus aciditrophicus (strain SB)
A6T2G1 1.84e-137 399 56 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Janthinobacterium sp. (strain Marseille)
Q7NPZ6 2.8e-137 397 57 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q748D3 3.51e-137 397 59 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2RVU1 2.35e-136 395 53 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5P6Z3 4.64e-136 394 57 2 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A4G8U1 1.03e-135 395 55 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Herminiimonas arsenicoxydans
A1KVL7 1.57e-135 393 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K0Y6 1.57e-135 393 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JSZ3 3.34e-135 392 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5NHK4 1.83e-134 390 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14J06 1.83e-134 390 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. tularensis (strain FSC 198)
A4IZH0 1.93e-134 390 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q5C1 3.15e-134 390 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. novicida (strain U112)
B2SDR9 8.5e-134 389 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. mediasiatica (strain FSC147)
A5CXA6 8.55e-134 389 50 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A9M2H7 1.68e-133 388 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria meningitidis serogroup C (strain 053442)
Q0BKM7 2.35e-133 388 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1Z8 2.35e-133 388 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. holarctica (strain LVS)
A7NDX5 2.35e-133 388 54 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B4RQC9 4.15e-133 387 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F6L4 4.15e-133 387 55 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q39YM2 6.41e-133 386 57 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B5ELC6 1.13e-132 386 55 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J3V5 1.13e-132 386 55 0 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
C0Q8P0 1.73e-132 385 53 3 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B8FBS1 5.76e-132 384 53 4 363 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfatibacillum aliphaticivorans
B0TZ73 7.96e-132 384 53 4 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A9I4U2 1.11e-130 382 55 4 390 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B6IRG5 1.41e-130 380 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodospirillum centenum (strain ATCC 51521 / SW)
B2UCY0 1.81e-130 381 53 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ralstonia pickettii (strain 12J)
A8ZXW6 2.06e-130 380 55 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q07PT6 5.39e-130 379 51 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain BisA53)
A4YZK6 9.39e-130 379 50 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bradyrhizobium sp. (strain ORS 278)
B1XT06 1.74e-129 379 53 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q313Q6 2.27e-129 377 54 4 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4SV71 3.47e-129 378 53 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8XVI4 4.45e-129 378 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5EPK7 4.93e-129 377 50 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q7VUQ0 6.6e-129 377 56 4 376 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WFR9 6.6e-129 377 56 4 376 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5FUK7 1.07e-128 376 52 3 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidiphilium cryptum (strain JF-5)
Q216E1 1.55e-128 375 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain BisB18)
Q7W4B1 1.88e-128 376 56 4 376 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q2W0H6 2.93e-128 375 55 2 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2IYL1 8.8e-128 374 50 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain HaA2)
Q89FU4 2.81e-127 372 51 1 350 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A0L5N4 3.23e-127 372 55 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1TKC8 5.7e-127 372 53 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paracidovorax citrulli (strain AAC00-1)
Q13TY9 6.63e-127 372 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paraburkholderia xenovorans (strain LB400)
B2SYX9 6.77e-127 372 52 4 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q2SZI6 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QJ4 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain K96243)
A3NDW7 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain 668)
Q3JND5 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain 1710b)
A1V0S1 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain SAVP1)
Q62GS4 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain ATCC 23344)
A2S5U8 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain NCTC 10229)
A3MR60 7.31e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia mallei (strain NCTC 10247)
A3NZL8 7.47e-127 372 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia pseudomallei (strain 1106a)
P59436 9.45e-127 370 54 0 336 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A9BUK3 1.03e-126 372 51 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q133W8 2.01e-126 370 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain BisB5)
A7HVU4 2.73e-126 370 53 2 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q1RI79 3.4e-126 369 51 5 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia bellii (strain RML369-C)
Q46WZ1 4e-126 370 51 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C4XK72 6.81e-126 369 52 4 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A6WZQ3 6.9e-126 369 50 1 360 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9AJ19 9.16e-126 369 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia multivorans (strain ATCC 17616 / 249)
B6JCF5 1.13e-125 368 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A4JB91 1.26e-125 369 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q21SW6 1.45e-125 369 51 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2JHG3 1.61e-125 369 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1WC09 2.15e-125 369 53 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidovorax sp. (strain JS42)
B9MFR5 2.15e-125 369 53 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidovorax ebreus (strain TPSY)
Q5LU74 2.19e-125 367 52 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q0BV22 2.19e-125 367 51 2 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A8GVM4 2.42e-125 367 51 5 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia bellii (strain OSU 85-389)
A5VRI0 3.01e-125 367 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q2K6B8 3.93e-125 367 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A4WQD0 4.8e-125 366 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q1BZG6 4.85e-125 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia orbicola (strain AU 1054)
B1JV75 4.85e-125 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia orbicola (strain MC0-3)
Q39JX3 4.85e-125 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E6J5 4.85e-125 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K483 4.85e-125 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia cenocepacia (strain HI2424)
B3PTW3 5.57e-125 367 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium etli (strain CIAT 652)
Q3STT1 8.81e-125 366 52 2 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1ME30 1.01e-124 366 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0BIK4 1.1e-124 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YSS1 1.1e-124 367 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Burkholderia ambifaria (strain MC40-6)
Q1LIM3 1.37e-124 366 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B5ZWJ7 1.83e-124 365 50 4 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A1AZK6 3e-124 364 51 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Paracoccus denitrificans (strain Pd 1222)
Q1QNU6 3.15e-124 365 51 2 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
C3MEN2 4.23e-124 364 50 3 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P64256 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella suis biovar 1 (strain 1330)
B0CHM3 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella suis (strain ATCC 23445 / NCTC 10510)
P64255 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RE73 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M693 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57C75 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella abortus biovar 1 (strain 9-941)
Q2YM68 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella abortus (strain 2308)
B2S6Q7 4.95e-124 364 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brucella abortus (strain S19)
Q3J4M8 5.06e-124 364 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PHS2 5.06e-124 364 53 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q0K6M1 8.25e-124 364 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q12EL8 2e-123 363 52 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B3R6W2 2.06e-123 363 52 5 389 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q52952 2.67e-123 362 50 3 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium meliloti (strain 1021)
B9KNJ3 3.52e-123 362 52 1 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
C5CNF1 9.17e-123 362 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Variovorax paradoxus (strain S110)
A6UB88 1.24e-122 360 50 3 367 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sinorhizobium medicae (strain WSM419)
B9JH54 1.77e-122 360 50 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A1VBE5 1.86e-122 360 54 3 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitratidesulfovibrio vulgaris (strain DP4)
Q728U5 1.86e-122 360 54 3 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q6N408 2.2e-122 360 51 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1IKG7 2.23e-122 360 49 4 379 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Koribacter versatilis (strain Ellin345)
B1XYR0 2.82e-122 360 52 6 393 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B3QFN4 4.1e-122 359 50 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhodopseudomonas palustris (strain TIE-1)
Q1GF14 4.52e-122 359 51 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Ruegeria sp. (strain TM1040)
Q9AKD8 8.14e-122 358 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B5YFT8 9.18e-122 358 50 1 344 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A5VDC9 3.13e-121 357 52 3 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A1VST9 4.38e-121 357 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Polaromonas naphthalenivorans (strain CJ2)
Q0AMW4 5.81e-121 356 51 4 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Maricaulis maris (strain MCS10)
A8GP69 8.03e-121 356 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia akari (strain Hartford)
A7IGE9 1.13e-120 355 52 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q2NCZ3 1.36e-120 355 51 3 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Erythrobacter litoralis (strain HTCC2594)
C4K1S5 2.58e-120 354 49 4 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia peacockii (strain Rustic)
Q11GS2 3.13e-120 354 49 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chelativorans sp. (strain BNC1)
A2SCY2 3.5e-120 355 50 5 393 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C6BYG9 3.65e-120 354 51 2 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q6MIF7 5.16e-120 353 51 3 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B9JY57 7.94e-120 353 49 5 369 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q98KB0 1.61e-119 352 51 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2G998 1.86e-119 352 52 5 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q1GRX6 4.32e-119 351 50 4 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q92H61 5.33e-119 351 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9AKP2 7.72e-119 351 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia montanensis
A8GSX5 1.02e-118 350 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii (strain Sheila Smith)
B0BYF0 1.02e-118 350 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii (strain Iowa)
Q9AKI9 1.02e-118 350 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia rickettsii
Q4FPK2 1.09e-118 350 48 1 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelagibacter ubique (strain HTCC1062)
A8F278 2.32e-118 349 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia massiliae (strain Mtu5)
Q9ZCW0 3.32e-118 349 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia prowazekii (strain Madrid E)
C3PP35 3.4e-118 349 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia africae (strain ESF-5)
Q7VQJ0 4.57e-118 349 47 2 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Blochmanniella floridana
Q4UMI7 2.66e-117 347 50 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B0UFH5 3.77e-117 346 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacterium sp. (strain 4-46)
B2IGF7 6.79e-117 346 52 5 363 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C1F461 1.28e-116 345 48 4 377 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
P56834 2.34e-116 344 51 3 337 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A1WRK8 2.84e-116 345 50 5 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Verminephrobacter eiseniae (strain EF01-2)
A8LSB0 1.14e-115 343 49 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B8H097 1.44e-115 343 48 4 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caulobacter vibrioides (strain NA1000 / CB15N)
A9IWA8 1.86e-115 342 52 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A8HZ57 2.42e-115 342 50 3 362 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8IMW7 1.19e-114 340 50 2 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A9H0I1 1.89e-114 340 50 3 359 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q8UDM5 2.43e-114 339 49 3 354 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Agrobacterium fabrum (strain C58 / ATCC 33970)
B7KU72 2.51e-114 339 51 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8EY83 5.56e-114 338 49 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Rickettsia canadensis (strain McKiel)
B1LXZ8 5.56e-114 338 50 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q6G121 6.4e-114 338 50 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella quintana (strain Toulouse)
Q5FUJ8 7.71e-114 338 49 2 347 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gluconobacter oxydans (strain 621H)
B1Z8W9 3.32e-113 336 50 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
C0R1X0 9.54e-113 336 46 2 369 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B0T834 1.1e-111 333 47 3 364 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caulobacter sp. (strain K31)
B8ETL9 2.14e-111 332 50 5 363 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B8IZT8 2.69e-111 331 50 4 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q01Q45 3.77e-111 332 48 5 375 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Solibacter usitatus (strain Ellin6076)
B4S6R2 3.29e-110 329 47 6 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q6G2Q2 3.55e-110 328 51 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q3B126 7.86e-110 328 47 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B1GZI2 2.23e-109 327 47 1 348 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Endomicrobium trichonymphae
A1UTC8 9.29e-109 325 50 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B3EQC1 5.35e-108 323 46 5 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeobacteroides (strain BS1)
B3QLW7 6.43e-108 323 45 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A1BJY1 1.18e-107 322 46 4 369 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A9FI43 3.31e-107 322 49 6 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sorangium cellulosum (strain So ce56)
B0SRS0 5.19e-107 321 46 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S986 5.19e-107 321 46 4 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B3QWT4 2.33e-106 319 48 6 358 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B4U9Q9 1.92e-105 317 46 5 364 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hydrogenobaculum sp. (strain Y04AAS1)
O66465 2.61e-105 316 48 4 363 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aquifex aeolicus (strain VF5)
B4SHE7 3.16e-105 316 47 3 351 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q1MPC2 3.28e-105 316 51 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Lawsonia intracellularis (strain PHE/MN1-00)
Q8KGD1 3.49e-104 313 43 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B4RFS3 7.97e-104 313 46 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Phenylobacterium zucineum (strain HLK1)
Q28NN1 8.18e-104 312 50 3 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Jannaschia sp. (strain CCS1)
B3EIL1 5.23e-103 311 44 5 372 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A4SH05 5.29e-103 310 45 6 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q3ANV6 5.4e-103 310 45 5 373 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Chlorobium chlorochromatii (strain CaD3)
Q661W1 2.12e-102 308 41 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B4UER8 2.98e-102 309 47 5 371 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter sp. (strain K)
Q2IG26 2.98e-102 309 47 5 371 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J8E5 2.98e-102 309 47 5 371 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q0SNK7 2.49e-101 306 41 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella afzelii (strain PKo)
B2S014 4.95e-101 305 43 2 341 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia hermsii (strain HS1 / DAH)
A1QZ99 2.72e-100 303 42 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia turicatae (strain 91E135)
B5RLC9 4.9e-100 302 42 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia duttonii (strain Ly)
B5RRC2 6.29e-100 302 42 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borrelia recurrentis (strain A1)
B7J1N1 3.54e-99 300 41 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella burgdorferi (strain ZS7)
Q44776 3.54e-99 300 41 2 342 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8F4J3 6.28e-99 300 45 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72R82 6.28e-99 300 45 3 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6MBS3 7.78e-99 301 43 7 392 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Protochlamydia amoebophila (strain UWE25)
C1A8A7 9.27e-99 300 44 4 380 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B3DVW4 1.88e-98 299 44 5 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Methylacidiphilum infernorum (isolate V4)
Q8RDQ0 5.85e-98 297 44 5 365 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A8EW04 8.33e-98 297 43 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Aliarcobacter butzleri (strain RM4018)
Q11RH2 1.29e-97 298 39 4 403 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A6Q1R7 2.66e-97 295 43 3 355 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nitratiruptor sp. (strain SB155-2)
Q7M7X0 8.15e-96 291 42 1 353 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q1D0S7 1.77e-95 292 45 5 374 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Myxococcus xanthus (strain DK1622)
B9KEZ5 2.28e-95 290 42 2 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
O25235 5.74e-95 290 45 4 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q30Q39 5.8e-95 290 42 4 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A8Z6N6 6.82e-95 289 43 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter concisus (strain 13826)
A7GWQ7 3.96e-94 287 43 2 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter curvus (strain 525.92)
Q9ZLY1 1.22e-93 286 44 4 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain J99 / ATCC 700824)
B9L7V6 3.75e-93 285 42 5 361 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q17XN0 3.91e-93 285 45 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter acinonychis (strain Sheeba)
Q04Y84 1.78e-92 284 44 1 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04V92 1.78e-92 284 44 1 370 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q0BXT9 3.29e-92 284 43 4 396 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Hyphomonas neptunium (strain ATCC 15444)
B3CVD3 3.64e-92 283 42 3 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Orientia tsutsugamushi (strain Ikeda)
Q1CU36 3.77e-92 282 45 4 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain HPAG1)
B6JL77 4.89e-92 282 45 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain P12)
B2UTZ3 6.32e-91 279 44 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter pylori (strain Shi470)
B3ER47 1.15e-90 280 36 6 404 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Amoebophilus asiaticus (strain 5a2)
A8FKM0 2.13e-90 278 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
C5D8M1 2.69e-90 276 45 4 335 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus sp. (strain WCH70)
Q2S531 2.7e-90 279 41 7 386 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Salinibacter ruber (strain DSM 13855 / M31)
A0RQL9 2.85e-90 278 42 3 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter fetus subsp. fetus (strain 82-40)
A7HH64 3.35e-90 278 49 7 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anaeromyxobacter sp. (strain Fw109-5)
A0Q060 4.06e-90 276 43 3 331 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium novyi (strain NT)
Q5HW33 4.35e-90 277 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni (strain RM1221)
A1VYF0 4.35e-90 277 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PI72 1.06e-89 276 43 3 349 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B7GGI5 4.56e-88 271 46 4 325 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A9VU75 9.7e-87 268 45 6 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus mycoides (strain KBAB4)
A0M530 1.06e-86 270 38 6 411 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A8MH33 2.03e-86 267 44 5 333 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Alkaliphilus oremlandii (strain OhILAs)
A4IM06 4.19e-86 266 45 6 331 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus thermodenitrificans (strain NG80-2)
Q6HEQ1 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636B3 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ZK / E33L)
B9IVZ0 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain Q1)
B7HM34 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain AH187)
C1EPS7 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain 03BB102)
B7IUS3 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain G9842)
Q732F5 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JK01 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain AH820)
A0RHT4 5.68e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus thuringiensis (strain Al Hakam)
Q81WC8 5.74e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis
C3L712 5.74e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P683 5.74e-86 266 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus anthracis (strain A0248)
Q5L0X8 1.62e-85 265 44 6 332 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Geobacillus kaustophilus (strain HTA426)
A5FIY0 1.83e-85 267 35 6 410 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A6H198 2.51e-85 267 36 5 409 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q819Q1 3.18e-85 264 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H6P9 3.18e-85 264 45 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cereus (strain B4264)
A7Z4E2 1.53e-84 262 45 6 338 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A5N7E7 6.24e-84 260 41 3 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E0W0 6.24e-84 260 41 3 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium kluyveri (strain NBRC 12016)
A6LEU6 1.1e-83 263 36 6 419 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B1ZU32 1.35e-83 261 41 9 374 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
A6QCC3 3.73e-83 259 42 5 346 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Sulfurovum sp. (strain NBC37-1)
Q03521 4.96e-83 258 46 6 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus subtilis (strain 168)
A7I3M7 6.73e-83 259 42 2 345 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q7VGZ9 1.03e-82 258 41 5 368 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9K9S6 1.76e-82 256 46 5 332 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7GRN9 2.23e-82 256 44 5 325 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q65JY3 4.71e-82 256 46 7 338 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B6YS29 2.55e-81 257 37 6 414 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Azobacteroides pseudotrichonymphae genomovar. CFP2
A3DE29 3.07e-81 254 42 6 330 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2TS25 3.98e-81 253 42 5 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium botulinum (strain Eklund 17B / Type B)
B2V4V5 5.81e-81 253 42 5 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Clostridium botulinum (strain Alaska E43 / Type E3)
Q8R9G3 2.56e-80 251 40 4 334 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5WFG7 4.78e-80 250 46 3 328 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Shouchella clausii (strain KSM-K16)
Q7MWM6 1.14e-79 253 36 7 419 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIE8 2.01e-79 252 36 7 419 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q2YXE0 2.87e-79 248 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B9DPR2 3.16e-79 248 43 7 339 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus carnosus (strain TM300)
A4J2A8 4.97e-79 248 47 5 326 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q2RK82 1.28e-78 246 43 4 336 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8NX36 2.29e-78 246 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MW2)
Q6GA30 2.29e-78 246 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MSSA476)
P0C1R8 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus
A8Z3M3 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GHQ3 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain MRSA252)
P68783 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain N315)
P68782 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG82 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain Newman)
Q5HGP9 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain COL)
A5IS68 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain JH9)
Q2FZ93 6e-78 245 43 5 327 1 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHQ5 6e-78 245 43 5 327 3 mraY Phospho-N-acetylmuramoyl-pentapeptide-transferase Staphylococcus aureus (strain USA300)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_05640
Feature type CDS
Gene mraY
Product phospho-N-acetylmuramoyl-pentapeptide-transferase
Location 118586 - 119668 (strand: -1)
Length 1083 (nucleotides) / 360 (amino acids)

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_860
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00953 Glycosyl transferase family 4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0472 Cell wall/membrane/envelope biogenesis (M) M UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01000 phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13] Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
-

Protein Sequence

MLIWLAEYLVQFHTAFNVFSYLTFRAIVGLLTSLIIALWMGPHVIAYLQRMQIGQVVRSEGPESHFSKRGTPTMGGMMILFSIAISVLLWARLDNPYVWCVLLVLIGYGIVGFIDDYRKVVRKDTKGLIARWKYFWQSVLALTVAFSMYAIGKDTPATQLVVPFFKDVMPQLGVLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFAHYLHIPYLPHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR

Flanking regions ( +/- flanking 50bp)

CGCAGCTCCGCAATGGAAGAAGTTGTGCACGCCTTGCAGGAGAATGTCCCATGCTGATTTGGCTGGCTGAGTATCTGGTGCAGTTTCATACCGCGTTTAACGTCTTCTCTTACCTGACGTTCCGCGCCATCGTCGGCCTGCTGACCTCGCTGATTATCGCATTATGGATGGGGCCGCATGTGATTGCGTATCTCCAGAGAATGCAGATTGGCCAGGTTGTCCGCAGCGAAGGGCCGGAATCGCACTTCAGCAAGCGCGGTACCCCGACCATGGGCGGCATGATGATCCTGTTCTCCATCGCCATTTCTGTTCTGCTGTGGGCGCGTCTGGACAACCCGTATGTCTGGTGTGTGCTGCTGGTGCTGATCGGCTACGGTATTGTCGGCTTTATCGATGACTACCGCAAAGTGGTGCGCAAAGACACCAAAGGGCTGATTGCCCGCTGGAAATATTTCTGGCAGTCCGTGCTGGCGCTGACTGTGGCGTTCAGTATGTATGCCATCGGTAAAGATACCCCGGCAACCCAGCTGGTGGTGCCGTTCTTTAAAGATGTGATGCCGCAGCTGGGTGTGCTGTATATCCTGCTGGCGTATTTCGTGATTGTCGGCACCAGTAACGCGGTGAACCTGACTGACGGCCTCGATGGTCTCGCGATTATGCCGACCGTCTTTGTGGCTGCCGGGTTTGCGCTGGTGGCGTGGGCGACCGGTAACGTGAATTTCGCGCATTATCTGCATATCCCGTATCTGCCGCATGCCGGGGAACTGGTGATTGTCTGCACCGCGATTGTCGGGGCAGGGCTGGGCTTCCTGTGGTTTAACACCTATCCGGCACAGGTCTTTATGGGTGATGTCGGTTCATTGGCACTCGGCGGCGCGCTGGGTACCATTGCTGTTCTGCTGCGTCAGGAATTCCTGCTGCTGATTATGGGCGGTGTATTCGTGGTGGAAACTCTGTCGGTGATTTTACAGGTCGGATCCTTCAAATTACGCGGTCAGCGTATTTTCCGGATGGCACCTATTCATCACCATTATGAATTAAAAGGCTGGCCTGAGCCGCGGGTGATTGTCCGCTTCTGGATTATCTCTCTGATGTTAGTGCTGATCGGTCTGGCGACACTCAAGGTACGTTAATCATGACGAATTATCAGGGGAAAGACATTGTGATTGTCGGGCTCGGTTTA