Homologs in group_898

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04165 FBDBKF_04165 93.6 Morganella morganii S1 zapA cell division protein ZapA
EHELCC_05455 EHELCC_05455 93.6 Morganella morganii S2 zapA cell division protein ZapA
NLDBIP_05775 NLDBIP_05775 93.6 Morganella morganii S4 zapA cell division protein ZapA
LHKJJB_02655 LHKJJB_02655 93.6 Morganella morganii S3 zapA cell division protein ZapA
HKOGLL_06130 HKOGLL_06130 93.6 Morganella morganii S5 zapA cell division protein ZapA
PMI_RS09990 PMI_RS09990 75.2 Proteus mirabilis HI4320 zapA cell division protein ZapA

Distribution of the homologs in the orthogroup group_898

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_898

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JPP1 8.49e-57 174 75 0 109 3 zapA Cell division protein ZapA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BAT7 9.17e-57 174 76 0 109 3 zapA Cell division protein ZapA Edwardsiella ictaluri (strain 93-146)
B2VF42 1.26e-56 173 76 0 109 3 zapA Cell division protein ZapA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6DA02 1.85e-56 173 75 0 109 3 zapA Cell division protein ZapA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DJT9 2.07e-56 173 75 0 109 3 zapA Cell division protein ZapA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8GIS6 2.16e-56 172 74 0 109 3 zapA Cell division protein ZapA Serratia proteamaculans (strain 568)
B1JNS0 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666R0 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CEZ2 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4K1 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pestis bv. Antiqua (strain Angola)
Q0WIC8 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pestis
B2K0R1 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB49 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FF14 4.6e-56 172 73 0 109 3 zapA Cell division protein ZapA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NRE3 7.62e-56 171 75 0 109 3 zapA Cell division protein ZapA Sodalis glossinidius (strain morsitans)
A7MR94 1.52e-55 171 78 0 103 3 zapA Cell division protein ZapA Cronobacter sakazakii (strain ATCC BAA-894)
A8APC0 2.16e-54 167 74 0 109 3 zapA Cell division protein ZapA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CPU9 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGR5 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella typhi
B5BFM5 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella paratyphi A (strain AKU_12601)
C0PY34 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella paratyphi C (strain RKS4594)
A9N3P2 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJH4 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T556 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella newport (strain SL254)
B4THE3 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella heidelberg (strain SL476)
B5RE21 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXI7 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella enteritidis PT4 (strain P125109)
Q57K55 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella choleraesuis (strain SC-B67)
B5F5I6 5.81e-54 166 73 0 109 3 zapA Cell division protein ZapA Salmonella agona (strain SL483)
A9MRG5 2.82e-53 165 72 0 109 3 zapA Cell division protein ZapA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5XUC8 1.76e-52 163 71 0 109 3 zapA Cell division protein ZapA Klebsiella pneumoniae (strain 342)
A4WE62 3.43e-52 162 75 0 103 3 zapA Cell division protein ZapA Enterobacter sp. (strain 638)
A6TDS2 6.14e-52 161 70 0 109 3 zapA Cell division protein ZapA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3YXW0 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Shigella sonnei (strain Ss046)
P0ADS5 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Shigella flexneri
Q0T0Y8 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Shigella flexneri serotype 5b (strain 8401)
Q31WH1 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Shigella boydii serotype 4 (strain Sb227)
B2U0S7 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LPC4 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R7B9 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain UTI89 / UPEC)
B1LDB2 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain SMS-3-5 / SECEC)
B6I743 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain SE11)
Q1JQN5 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli
B7N7F3 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ADS2 3.59e-51 159 70 0 109 1 zapA Cell division protein ZapA Escherichia coli (strain K12)
B1IT92 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ADS3 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDU2 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AF99 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O1:K1 / APEC
A8A451 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O9:H4 (strain HS)
B1XEJ6 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain K12 / DH10B)
C5A0I2 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYH4 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O8 (strain IAI1)
B7MZK7 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O81 (strain ED1a)
B7NHX1 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQA4 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ADS4 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O157:H7
B7LFG9 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli (strain 55989 / EAEC)
B7MM96 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHV8 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZR20 3.59e-51 159 70 0 109 3 zapA Cell division protein ZapA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32BX2 2.01e-50 157 69 0 109 3 zapA Cell division protein ZapA Shigella dysenteriae serotype 1 (strain Sd197)
A3MYI2 1.29e-16 72 47 0 74 3 zapA Cell division protein ZapA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BS15 2.48e-16 71 47 0 74 3 zapA Cell division protein ZapA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q7VMH6 5.71e-16 70 48 0 74 3 zapA Cell division protein ZapA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CKA3 2.31e-14 66 35 0 94 3 zapA Cell division protein ZapA Pasteurella multocida (strain Pm70)
B0UTH6 7.52e-14 65 35 0 93 3 zapA Cell division protein ZapA Histophilus somni (strain 2336)
Q0I2U9 7.52e-14 65 35 0 93 3 zapA Cell division protein ZapA Histophilus somni (strain 129Pt)
Q65VC6 6.89e-12 60 32 0 91 3 zapA Cell division protein ZapA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VM35 1.33e-11 59 38 0 73 3 zapA Cell division protein ZapA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44062 2.63e-08 50 32 0 91 3 zapA Cell division protein ZapA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UI04 2.63e-08 50 32 0 91 3 zapA Cell division protein ZapA Haemophilus influenzae (strain PittGG)
A5UDL7 2.63e-08 50 32 0 91 3 zapA Cell division protein ZapA Haemophilus influenzae (strain PittEE)
Q4QM44 2.63e-08 50 32 0 91 3 zapA Cell division protein ZapA Haemophilus influenzae (strain 86-028NP)
Q9HTW3 1.08e-06 46 22 0 87 1 zapA Cell division protein ZapA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08610
Feature type CDS
Gene zapA
Product cell division protein ZapA
Location 1779029 - 1779358 (strand: 1)
Length 330 (nucleotides) / 109 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_898
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05164 Cell division protein ZapA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3027 Cell cycle control, cell division, chromosome partitioning (D) D Cell division protein ZapA, inhibits GTPase activity of FtsZ

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09888 cell division protein ZapA - -

Protein Sequence

MSAQPVDIQIFGRSMRVNCPPEQKEALVASAAELEQRLQDLKVRSKVTNTEQLVFIVALNICHELTQEKLKTRDYAYNMEQKIKLLQQTIEQALHDQTRITERQVTSIE

Flanking regions ( +/- flanking 50bp)

CCACGATACACAGGATAAAATATCCTGTAGCAGAACTAAAGGAAGATGTCATGTCTGCACAACCCGTTGATATCCAAATATTCGGGCGTTCCATGCGCGTTAATTGTCCACCGGAACAGAAAGAAGCACTGGTTGCTTCTGCTGCGGAGCTTGAACAACGGCTGCAGGACCTGAAAGTACGCAGTAAAGTGACTAATACCGAGCAGCTCGTTTTTATCGTCGCATTGAACATTTGTCACGAACTGACACAAGAAAAATTGAAAACGCGCGATTATGCCTATAACATGGAACAGAAGATAAAATTGTTACAGCAGACTATCGAGCAGGCACTTCATGATCAAACACGAATCACTGAGCGCCAGGTAACATCTATTGAGTAAATTTGTTTAGAAATCAGTCACTAGACAAAAAAAATAGTGAAATTAGGTTG