Homologs in group_886

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04105 FBDBKF_04105 89.0 Morganella morganii S1 fldB flavodoxin FldB
EHELCC_05395 EHELCC_05395 89.0 Morganella morganii S2 fldB flavodoxin FldB
NLDBIP_05715 NLDBIP_05715 89.0 Morganella morganii S4 fldB flavodoxin FldB
LHKJJB_02595 LHKJJB_02595 89.0 Morganella morganii S3 fldB flavodoxin FldB
HKOGLL_06070 HKOGLL_06070 89.0 Morganella morganii S5 fldB flavodoxin FldB
PMI_RS09925 PMI_RS09925 70.3 Proteus mirabilis HI4320 fldB flavodoxin FldB

Distribution of the homologs in the orthogroup group_886

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_886

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1N6 5.66e-85 250 72 0 167 3 fldB Flavodoxin 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1N7 5.66e-85 250 72 0 167 3 fldB Flavodoxin 2 Salmonella typhi
P0ABY4 3.61e-84 248 70 0 167 1 fldB Flavodoxin 2 Escherichia coli (strain K12)
P0ABY5 3.61e-84 248 70 0 167 3 fldB Flavodoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABY6 3.61e-84 248 70 0 167 3 fldB Flavodoxin 2 Escherichia coli O157:H7
P0A3E0 1.82e-48 157 48 2 166 1 isiB Flavodoxin Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A3D9 1.82e-48 157 48 2 166 1 isiB Flavodoxin Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P10340 3.14e-47 154 46 2 167 1 isiB Flavodoxin Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O07026 4.87e-44 146 43 1 165 2 fldA Flavodoxin Klebsiella pneumoniae
P61949 2.26e-43 145 42 1 164 1 fldA Flavodoxin 1 Escherichia coli (strain K12)
P61950 2.26e-43 145 42 1 164 3 fldA Flavodoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P61951 2.26e-43 145 42 1 164 3 fldA Flavodoxin 1 Escherichia coli O157:H7
Q8ZQX1 2.35e-42 142 42 1 164 1 fldA Flavodoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P44562 4.02e-42 141 40 1 165 3 fldA Flavodoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89AK0 1.62e-40 137 38 2 171 3 fldA Flavodoxin Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P27319 7.37e-40 135 43 3 164 1 isiB Flavodoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q83S80 1.74e-39 135 40 1 164 3 fldA Flavodoxin 1 Shigella flexneri
P31158 4.89e-39 133 43 3 164 2 isiB Flavodoxin Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P57385 8.03e-39 133 39 1 164 3 fldA Flavodoxin Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O52659 2.3e-37 129 45 4 168 3 fld Flavodoxin Trichodesmium erythraeum (strain IMS101)
Q8K9N5 8.72e-37 127 43 1 153 3 fldA Flavodoxin Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P23001 7.99e-32 115 40 4 175 1 nifF Flavodoxin B Azotobacter chroococcum mcd 1
P52964 2.3e-31 114 38 5 172 1 Avin_45950 Flavodoxin 1 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P71169 3.94e-31 113 40 2 166 3 nifF Flavodoxin Enterobacter agglomerans
P00324 4.22e-31 114 40 4 175 1 nifF Flavodoxin 2 Azotobacter vinelandii
P28579 2.75e-30 111 39 2 166 3 nifF Flavodoxin Enterobacter agglomerans
P04668 8.24e-30 110 36 2 171 3 nifF Flavodoxin Klebsiella pneumoniae
Q9ZK53 7.27e-27 102 36 3 163 1 fldA Flavodoxin Helicobacter pylori (strain J99 / ATCC 700824)
O25776 1.14e-26 102 36 3 163 1 fldA Flavodoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P52967 3.33e-24 96 35 3 169 1 nifF Flavodoxin Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P14070 4.48e-22 90 35 4 173 1 None Flavodoxin Chondrus crispus
Q01095 2.16e-10 59 35 4 117 1 None Flavodoxin Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
P18086 7.3e-10 57 33 5 118 3 Desal_0805 Flavodoxin Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
P00323 1.22e-09 57 33 4 118 1 DVU_2680 Flavodoxin Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q01096 9.81e-09 54 31 5 118 3 None Flavodoxin Megalodesulfovibrio gigas
P26492 4.18e-08 53 25 5 139 1 None Flavodoxin Desulfovibrio desulfuricans
P80312 5.43e-06 47 22 5 138 1 Ddes_1951 Flavodoxin Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
O34589 1.1e-05 46 30 3 120 3 ykuP Probable flavodoxin 2 Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08545
Feature type CDS
Gene fldB
Product flavodoxin FldB
Location 1764841 - 1765359 (strand: 1)
Length 519 (nucleotides) / 172 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_886
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00258 Flavodoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0716 Energy production and conversion (C) C Flavodoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03840 flavodoxin II - -

Protein Sequence

MKIGLFYGSSTCYTEMAAEKIRDILGEDLVELHDVKDAAPGLMETYPVLILGIPTWDFGEIQEDWLAIWESLPQLNLSGKIVALYGMGDQVDYSDWFLDALGYLHQQLLATGVQFVGYWPVDGYTFTSPKALTPDGKHFVGLALDDVNQYDESEERIATWCMQVLEETEALL

Flanking regions ( +/- flanking 50bp)

GTGACAGGCATGCTCTCATTCTCTGACCTGACATACAGCAGAATAAATAAATGAAAATTGGTCTTTTTTATGGCTCCAGTACCTGCTACACCGAAATGGCGGCAGAAAAAATCCGCGATATTTTAGGTGAAGATCTTGTTGAACTCCATGATGTGAAAGACGCCGCGCCCGGGCTGATGGAAACCTATCCGGTACTGATCTTAGGTATTCCGACATGGGATTTCGGGGAGATTCAGGAGGACTGGCTGGCTATCTGGGAAAGCCTGCCGCAGCTTAATCTTTCCGGTAAAATTGTTGCCCTGTACGGCATGGGTGACCAGGTGGATTACAGTGACTGGTTCCTGGATGCTCTGGGCTATCTGCATCAGCAATTACTGGCAACCGGCGTACAGTTTGTCGGTTACTGGCCGGTTGACGGCTATACCTTTACCAGCCCGAAGGCGCTCACGCCGGATGGAAAGCACTTTGTCGGCCTGGCACTGGATGATGTCAATCAATATGACGAAAGCGAAGAGCGCATTGCAACCTGGTGTATGCAGGTGCTGGAAGAAACAGAAGCCCTGTTGTAAACCACCACGTGTGTAAATGGCACTAATCTGTAAATAGCATTCATTAAAGC