Homologs in group_3841
1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS13300 | PMI_RS13300 | 27.6 | Proteus mirabilis HI4320 | sctF | type III secretion system needle filament subunit SctF |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P95434 | 3.38e-20 | 79 | 46 | 2 | 86 | 1 | sctF | Type 3 secretion system needle filament protein | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Q01247 | 8.38e-17 | 71 | 47 | 0 | 71 | 1 | sctF | Type 3 secretion system needle filament protein | Yersinia enterocolitica |
| O68691 | 3.58e-16 | 69 | 47 | 0 | 71 | 1 | sctF | Type 3 secretion system needle filament protein | Yersinia pestis |
| P0A224 | 6.13e-05 | 40 | 37 | 0 | 56 | 3 | sctF | Type 3 secretion system needle filament protein | Shigella sonnei |
| P0A223 | 6.13e-05 | 40 | 37 | 0 | 56 | 1 | sctF | Type 3 secretion system needle filament protein | Shigella flexneri |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS08375 |
| Feature type | CDS |
| Gene | sctF |
| Product | type III secretion system needle filament subunit SctF |
| Location | 1735119 - 1735373 (strand: 1) |
| Length | 255 (nucleotides) / 84 (amino acids) |
| Accession | term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object |
|---|---|
| Length | 2012992 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3841 | |
|---|---|---|
| Orthogroup size | 2 | |
| N. genomes | 2 |
| PF09392 | Type III secretion needle MxiH, YscF, SsaG, EprI, PscF, EscF |
|---|
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K03221 | type III secretion protein F | Bacterial secretion system Pathogenic Escherichia coli infection Shigellosis Salmonella infection |
EHEC/EPEC pathogenicity signature, T3SS and effectors |
MPIIFDPSRPGSILDEILLSLKDQALANENELKDAIENLKQNPDNPALLQELQYRTTKWSLVFNTASSLVKSMKDIMQNILQKI
CATTAACTGCGGCTGAAATTATTCTGCATACATTATGTTAGAGGGAACTTATGCCAATTATTTTTGATCCATCCAGGCCGGGAAGCATACTGGATGAAATCCTCCTCAGTTTAAAAGATCAGGCTCTGGCCAATGAAAATGAACTGAAAGACGCTATTGAAAATTTAAAACAGAACCCTGACAACCCTGCGCTGTTACAGGAGTTACAATACAGAACGACCAAATGGAGTCTTGTTTTTAATACTGCGTCGTCATTAGTAAAATCTATGAAAGATATTATGCAGAATATATTACAAAAAATATGACTGATTATTCGGATGAACGTCTTCTCGCTGAAATTTCTCTGGCCGGTATT
