Homologs in group_1672

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11625 FBDBKF_11625 90.4 Morganella morganii S1 - DUF3820 domain-containing protein
EHELCC_17545 EHELCC_17545 90.4 Morganella morganii S2 - DUF3820 domain-containing protein
NLDBIP_18755 NLDBIP_18755 90.4 Morganella morganii S4 - DUF3820 domain-containing protein
LHKJJB_17985 LHKJJB_17985 90.4 Morganella morganii S3 - DUF3820 domain-containing protein
HKOGLL_18665 HKOGLL_18665 90.4 Morganella morganii S5 - DUF3820 domain-containing protein
PMI_RS08985 PMI_RS08985 70.8 Proteus mirabilis HI4320 - DUF3820 family protein

Distribution of the homologs in the orthogroup group_1672

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1672

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD40 2.63e-34 114 76 0 71 4 ypeB Uncharacterized protein YpeB Escherichia coli (strain K12)
P0AD41 2.63e-34 114 76 0 71 4 ypeB Uncharacterized protein YpeB Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08055
Feature type CDS
Gene -
Product DUF3820 family protein
Location 1671768 - 1671989 (strand: -1)
Length 222 (nucleotides) / 73 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1672
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12843 Putative quorum-sensing-regulated virulence factor

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3530 Function unknown (S) S Uncharacterized conserved protein, DUF3820 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09954 uncharacterized protein - -

Protein Sequence

MNKEDLVAIANTAMPFGKYKGCCLIDLPEEYLLWFARKDSFPEGRLGQLMQITLTIKIEGLSGLIKPLKRPSH

Flanking regions ( +/- flanking 50bp)

AATCTTACGGTCTTCTGAGGAAGACCGTTTAAACCACCTCAGGTGAGATGATGAATAAAGAAGATTTAGTGGCCATCGCGAACACCGCTATGCCTTTTGGTAAGTACAAAGGTTGCTGTTTAATCGACCTGCCCGAAGAGTATCTGCTTTGGTTTGCGCGTAAAGACAGTTTTCCCGAAGGGCGTTTAGGTCAGCTGATGCAAATTACCCTCACCATTAAAATTGAAGGTTTAAGTGGTCTGATAAAACCGCTCAAACGACCGTCTCACTGATCACGGGTCAGTGCATCGATAACCTTCTGGCTCAATATACGAAACTGACG