Homologs in group_1715

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11625 FBDBKF_11625 100.0 Morganella morganii S1 - DUF3820 domain-containing protein
EHELCC_17545 EHELCC_17545 100.0 Morganella morganii S2 - DUF3820 domain-containing protein
NLDBIP_18755 NLDBIP_18755 100.0 Morganella morganii S4 - DUF3820 domain-containing protein
HKOGLL_18665 HKOGLL_18665 100.0 Morganella morganii S5 - DUF3820 domain-containing protein
F4V73_RS08055 F4V73_RS08055 90.4 Morganella psychrotolerans - DUF3820 family protein
PMI_RS08985 PMI_RS08985 69.4 Proteus mirabilis HI4320 - DUF3820 family protein

Distribution of the homologs in the orthogroup group_1715

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1715

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD40 3.26e-36 119 77 0 71 4 ypeB Uncharacterized protein YpeB Escherichia coli (strain K12)
P0AD41 3.26e-36 119 77 0 71 4 ypeB Uncharacterized protein YpeB Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_17985
Feature type CDS
Gene -
Product DUF3820 domain-containing protein
Location 19989 - 20210 (strand: 1)
Length 222 (nucleotides) / 73 (amino acids)
In genomic island -

Contig

Accession ZDB_381
Length 42053 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1715
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12843 Putative quorum-sensing-regulated virulence factor

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3530 Function unknown (S) S Uncharacterized conserved protein, DUF3820 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09954 uncharacterized protein - -

Protein Sequence

MEKEDLVAVANTAMPFGKYKGCRLIDLPEEYLLWFARKDSFPEGRLGQLMQLTLAIKTEGLSGLIKPLKRPAH

Flanking regions ( +/- flanking 50bp)

TGAAAAACGGTCTTCCGCAGAAGACCGTTTCAGTCACATCAGGAGAGATGATGGAGAAAGAAGATTTAGTGGCAGTCGCTAACACGGCTATGCCATTTGGTAAATACAAAGGTTGCCGTTTAATTGACCTTCCCGAGGAATACCTGCTCTGGTTTGCCCGTAAAGACAGTTTCCCGGAAGGGCGCCTGGGGCAGCTGATGCAACTCACCCTTGCGATTAAAACCGAAGGTTTAAGTGGCCTGATAAAACCGCTTAAACGTCCCGCTCACTGATCCCGGGTCAGTGCATCGATAACTTTCCGGCTCAGTATACGAAACTGGCG