Homologs in group_2514

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01075 FBDBKF_01075 82.3 Morganella morganii S1 uspA Nucleotide-binding universal stress protein, UspA family
EHELCC_00470 EHELCC_00470 82.3 Morganella morganii S2 uspA Nucleotide-binding universal stress protein, UspA family
NLDBIP_02990 NLDBIP_02990 82.3 Morganella morganii S4 uspA Nucleotide-binding universal stress protein, UspA family
LHKJJB_04505 LHKJJB_04505 82.3 Morganella morganii S3 uspA Nucleotide-binding universal stress protein, UspA family
HKOGLL_02540 HKOGLL_02540 82.3 Morganella morganii S5 uspA Nucleotide-binding universal stress protein, UspA family

Distribution of the homologs in the orthogroup group_2514

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2514

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P67091 2.19e-25 97 38 4 152 1 uspF Universal stress protein F Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67092 2.19e-25 97 38 4 152 3 uspF Universal stress protein F Salmonella typhi
P37903 8.51e-24 93 38 4 152 1 uspF Universal stress protein F Escherichia coli (strain K12)
P0A4P8 3.22e-23 91 38 4 152 3 uspF Universal stress protein F Shigella flexneri
P0A4P6 3.22e-23 91 38 4 152 3 uspF Universal stress protein F Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TI19 3.22e-23 91 38 4 152 3 uspF Universal stress protein F Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0A4P7 3.22e-23 91 38 4 152 3 uspF Universal stress protein F Escherichia coli O157:H7
P39177 4.32e-19 80 33 2 147 1 uspG Universal stress protein UP12 Escherichia coli (strain K12)
Q8XBT3 6.65e-19 80 33 2 147 3 uspG Universal stress protein G Escherichia coli O157:H7
Q8FK07 2.08e-18 79 33 2 147 3 uspG Universal stress protein G Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83M07 3.41e-18 78 32 2 147 3 uspG Universal stress protein G Shigella flexneri
P67093 2.68e-16 73 30 2 147 3 uspG Universal stress protein G Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67094 2.68e-16 73 30 2 147 3 uspG Universal stress protein G Salmonella typhi
Q57951 8.93e-09 54 30 6 155 3 MJ0531 Universal stress protein MJ0531 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q83AC1 1.65e-06 48 33 5 148 3 uspA1 Universal stress protein A homolog 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
O07552 8.94e-06 46 42 1 56 2 nhaX Stress response protein NhaX Bacillus subtilis (strain 168)
P9WFD1 1.11e-05 47 29 5 101 1 Rv2026c Universal stress protein Rv2026c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFD0 1.11e-05 47 29 5 101 3 MT2085 Universal stress protein MT2085 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q50777 1.84e-05 45 38 1 57 3 MTBMA_c15380 Universal stress protein MTBMA_c15380 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P45680 2.21e-05 45 24 5 147 1 uspA2 Universal stress protein A homolog 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
O27222 0.000116 43 34 0 52 3 MTH_1154 Universal stress protein MTH_1154 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
E1VBK4 0.00045 41 34 1 72 1 teaD TRAP-T-associated universal stress protein TeaD Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07895
Feature type CDS
Gene -
Product universal stress protein
Location 1648152 - 1648595 (strand: -1)
Length 444 (nucleotides) / 147 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2514
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00582 Universal stress protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0589 Signal transduction mechanisms (T) T Nucleotide-binding universal stress protein, UspA family

Protein Sequence

MHKTILIPIDLNTGALSPNVIAEVNDYARDKNIKFHFVTVILPSEQLFDYGLTFPIMTDNAKSEDQRIKLLLEKLETMTDKFDVPKNQISTGVLLGSPAEAIIENAEKIKADLIIIGSKNPTLKSRLLGSTASALIHYANISVLVVR

Flanking regions ( +/- flanking 50bp)

GTTTCAGTTTTAAGCAGGTAAATTAATCAATCTGATATAAAGGAGCGGTTATGCACAAGACGATACTTATCCCGATTGACCTGAATACAGGTGCGTTATCACCAAATGTAATTGCTGAAGTTAATGATTACGCCCGGGACAAAAATATTAAATTCCATTTTGTTACTGTGATTTTACCGTCAGAACAGCTTTTTGATTATGGGCTGACATTCCCTATTATGACAGATAATGCAAAATCTGAAGACCAGCGCATTAAACTTTTATTAGAAAAACTTGAAACAATGACTGATAAATTTGATGTGCCGAAAAATCAAATTTCCACCGGTGTGCTGCTCGGCAGCCCGGCAGAAGCCATTATTGAAAATGCAGAAAAAATCAAAGCTGATCTGATCATTATCGGGTCAAAAAATCCGACATTGAAAAGTCGTCTCCTTGGTTCAACAGCATCTGCGCTGATTCACTACGCAAATATTTCTGTGCTTGTTGTCCGATAAATACAAGCCCGTTAAATCGGGCTTTTTCACGTTTTTACGTCAATGTCCAC