Homologs in group_1955

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14665 FBDBKF_14665 70.0 Morganella morganii S1 cotS Thiamine kinase or a related kinase
EHELCC_15470 EHELCC_15470 70.0 Morganella morganii S2 cotS Thiamine kinase or a related kinase
NLDBIP_16000 NLDBIP_16000 70.0 Morganella morganii S4 cotS Thiamine kinase or a related kinase
LHKJJB_15840 LHKJJB_15840 70.0 Morganella morganii S3 cotS Thiamine kinase or a related kinase
HKOGLL_14960 HKOGLL_14960 70.0 Morganella morganii S5 cotS Thiamine kinase or a related kinase
PMI_RS04280 PMI_RS04280 36.0 Proteus mirabilis HI4320 - phosphotransferase

Distribution of the homologs in the orthogroup group_1955

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1955

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1IUF9 4.65e-32 122 34 6 244 3 thiK Thiamine kinase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ64 4.65e-32 122 34 6 244 3 thiK Thiamine kinase Escherichia coli O9:H4 (strain HS)
B7NAY4 2.87e-31 120 34 6 244 3 thiK Thiamine kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7UPC2 2.87e-31 120 34 6 244 3 thiK Thiamine kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZKL0 2.87e-31 120 34 6 244 3 thiK Thiamine kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
P75948 4.02e-31 120 34 6 244 1 thiK Thiamine kinase Escherichia coli (strain K12)
B1XA16 4.02e-31 120 34 6 244 3 thiK Thiamine kinase Escherichia coli (strain K12 / DH10B)
C4ZS46 4.02e-31 120 34 6 244 3 thiK Thiamine kinase Escherichia coli (strain K12 / MC4100 / BW2952)
Q8X8G6 5.12e-31 119 34 6 244 3 thiK Thiamine kinase Escherichia coli O157:H7
Q83LH9 6.12e-31 119 34 6 244 3 thiK Thiamine kinase Shigella flexneri
Q0T5T0 6.12e-31 119 34 6 244 3 thiK Thiamine kinase Shigella flexneri serotype 5b (strain 8401)
Q32EW6 1.29e-30 118 34 6 244 3 thiK Thiamine kinase Shigella dysenteriae serotype 1 (strain Sd197)
Q31ZG3 1.37e-30 118 34 6 244 3 thiK Thiamine kinase Shigella boydii serotype 4 (strain Sb227)
Q3Z311 1.51e-30 118 34 6 244 3 thiK Thiamine kinase Shigella sonnei (strain Ss046)
B1LI38 1.71e-30 118 34 6 244 3 thiK Thiamine kinase Escherichia coli (strain SMS-3-5 / SECEC)
B5YVX5 1.73e-30 118 34 6 244 3 thiK Thiamine kinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q1RD48 1.14e-29 116 33 6 244 3 thiK Thiamine kinase Escherichia coli (strain UTI89 / UPEC)
A1AA00 1.14e-29 116 33 6 244 3 thiK Thiamine kinase Escherichia coli O1:K1 / APEC
B7MJ93 1.14e-29 116 33 6 244 3 thiK Thiamine kinase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8FIN3 1.18e-29 116 33 6 244 3 thiK Thiamine kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIW8 1.93e-29 115 33 6 243 3 thiK Thiamine kinase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MTN6 3.06e-29 115 33 6 244 3 thiK Thiamine kinase Escherichia coli O81 (strain ED1a)
A9N5J7 1.26e-24 102 34 7 241 3 thiK Thiamine kinase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T340 1.26e-24 102 34 7 241 3 thiK Thiamine kinase Salmonella newport (strain SL254)
B4TTH8 1.45e-24 102 33 6 240 3 thiK Thiamine kinase Salmonella schwarzengrund (strain CVM19633)
C0Q785 1.95e-24 102 34 7 241 3 thiK Thiamine kinase Salmonella paratyphi C (strain RKS4594)
Q57QE7 1.95e-24 102 34 7 241 3 thiK Thiamine kinase Salmonella choleraesuis (strain SC-B67)
Q8Z7I7 3.34e-24 101 33 6 240 3 thiK Thiamine kinase Salmonella typhi
B5F8E6 3.34e-24 101 33 6 240 3 thiK Thiamine kinase Salmonella agona (strain SL483)
B5QXC8 4.41e-24 101 33 6 240 3 thiK Thiamine kinase Salmonella enteritidis PT4 (strain P125109)
B5FK99 4.41e-24 101 33 6 240 3 thiK Thiamine kinase Salmonella dublin (strain CT_02021853)
B5BAG8 4.84e-24 101 33 6 240 3 thiK Thiamine kinase Salmonella paratyphi A (strain AKU_12601)
Q5PGS9 4.84e-24 101 33 6 240 3 thiK Thiamine kinase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TFI3 5.48e-24 100 33 6 240 3 thiK Thiamine kinase Salmonella heidelberg (strain SL476)
Q8ZQ07 5.95e-24 100 33 6 240 3 thiK Thiamine kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RB94 1.38e-22 97 32 7 246 3 thiK Thiamine kinase Salmonella gallinarum (strain 287/91 / NCTC 13346)
P43044 9.12e-08 55 23 6 202 3 licA Protein LicA homolog Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07460
Feature type CDS
Gene -
Product phosphotransferase
Location 1561412 - 1562254 (strand: -1)
Length 843 (nucleotides) / 280 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1955
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01636 Phosphotransferase enzyme family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0510 Coenzyme transport and metabolism (H) H Thiamine kinase or a related kinase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07251 thiamine kinase [EC:2.7.1.89] Thiamine metabolism
Metabolic pathways		 -

Protein Sequence

MSSNCGLLQCLRDHFPALPAAGWVIRPLTGLTQGSVSIEQAGIRLIGRAPVAHSAGPGVSRRKEARILSGLRHSGFVPHMSGYSHGWLLLHRVEGDTLAPGRMASADFMPQLAALISRLHAEPLTGYRLPLKAQVQHHYQQMDKRRLTPRWRAVHRAFMHLPEPHPLKLAPAHMDIHPGNIIMSGTKLSLIDWEYAADTDIGLSLAALFRANNWSLTLINTFLRYYSGYHCPQRVLLQTRRWQRRTDYMMLMWFEGRWAHTGDPQFLQHSAPLMTALGIR

Flanking regions ( +/- flanking 50bp)

GATGTCTGTCGTCAGCGGTGAAATTATCTGGTCCGGTAAGGACGCGGTGCTTGAGCAGTAACTGCGGATTATTGCAGTGCCTGCGCGATCATTTTCCTGCGCTGCCCGCAGCGGGTTGGGTTATTCGCCCGCTGACCGGGCTGACGCAGGGAAGTGTCAGTATTGAACAAGCCGGTATTCGTCTTATCGGGCGCGCGCCTGTCGCACACAGTGCGGGTCCGGGTGTCAGCCGCCGGAAAGAAGCGCGTATTCTTTCAGGGCTGCGTCACAGCGGATTTGTCCCGCATATGTCGGGCTATAGTCATGGCTGGCTGTTATTGCACAGAGTAGAGGGCGATACACTTGCACCGGGTCGTATGGCATCCGCTGATTTTATGCCGCAACTGGCGGCACTTATCAGTCGTCTGCATGCAGAGCCGTTAACGGGTTACCGGTTGCCGTTGAAAGCACAGGTGCAGCACCATTATCAGCAGATGGATAAACGCCGTCTCACACCGCGCTGGCGGGCGGTTCACCGCGCATTTATGCACTTACCGGAGCCGCATCCGCTGAAACTTGCGCCTGCGCACATGGATATCCATCCCGGTAATATCATTATGTCCGGCACTAAGCTCAGTCTGATTGACTGGGAGTACGCCGCCGACACGGATATCGGCCTGTCCCTCGCGGCACTTTTTCGTGCAAACAACTGGTCATTGACGTTAATTAACACTTTTCTGCGTTATTATTCAGGCTATCACTGTCCGCAGCGTGTGCTGCTGCAAACCCGCCGCTGGCAGCGCCGGACAGATTATATGATGCTAATGTGGTTTGAGGGTCGCTGGGCGCATACCGGCGATCCGCAGTTTCTGCAACACTCTGCGCCGCTGATGACAGCGCTCGGGATCAGATAAATACAAAGGGGTATCGTCATGGGACCTGTAATGTTAGATGTTGAAGGGTA