Homologs in group_1954

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14660 FBDBKF_14660 93.5 Morganella morganii S1 nagZ beta-N-acetylhexosaminidase
EHELCC_15465 EHELCC_15465 93.5 Morganella morganii S2 nagZ beta-N-acetylhexosaminidase
NLDBIP_15995 NLDBIP_15995 93.5 Morganella morganii S4 nagZ beta-N-acetylhexosaminidase
LHKJJB_15845 LHKJJB_15845 93.5 Morganella morganii S3 nagZ beta-N-acetylhexosaminidase
HKOGLL_14965 HKOGLL_14965 93.5 Morganella morganii S5 nagZ beta-N-acetylhexosaminidase
PMI_RS04285 PMI_RS04285 74.6 Proteus mirabilis HI4320 nagZ beta-N-acetylhexosaminidase

Distribution of the homologs in the orthogroup group_1954

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1954

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVE7 0.0 529 74 1 340 3 nagZ Beta-hexosaminidase Proteus mirabilis (strain HI4320)
Q7N397 0.0 525 73 1 340 3 nagZ Beta-hexosaminidase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P75949 3.33e-178 499 71 2 339 1 nagZ Beta-hexosaminidase Escherichia coli (strain K12)
B1XA17 3.33e-178 499 71 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain K12 / DH10B)
C4ZS47 3.33e-178 499 71 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain K12 / MC4100 / BW2952)
A1JME4 6.57e-178 499 74 2 336 3 nagZ Beta-hexosaminidase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JI47 4.3e-177 497 73 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FH41 4.3e-177 497 73 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7ZKL1 5.93e-177 496 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LI37 6.4e-177 496 71 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain SMS-3-5 / SECEC)
B7NAY5 6.4e-177 496 71 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NKH2 6.4e-177 496 71 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B6I9I5 1.16e-176 496 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain SE11)
B7LX41 1.16e-176 496 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O8 (strain IAI1)
B7LG40 1.16e-176 496 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain 55989 / EAEC)
B1IUF8 1.91e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ65 1.91e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O9:H4 (strain HS)
Q7UCW4 2.02e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Shigella flexneri
Q1RD47 2.02e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli (strain UTI89 / UPEC)
B7MJ94 2.02e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7MTN7 2.93e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O81 (strain ED1a)
B7UPC3 2.93e-176 495 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8ZFS3 3.4e-176 494 73 2 336 3 nagZ Beta-hexosaminidase Yersinia pestis
Q669N5 4.89e-176 494 73 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K731 4.89e-176 494 73 2 336 3 nagZ Beta-hexosaminidase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q32EW7 1.53e-175 493 70 2 339 3 nagZ Beta-hexosaminidase Shigella dysenteriae serotype 1 (strain Sd197)
A7MFT1 2.71e-175 492 71 2 337 3 nagZ Beta-hexosaminidase Cronobacter sakazakii (strain ATCC BAA-894)
A1AA01 3.41e-175 492 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O1:K1 / APEC
Q31ZG4 3.89e-175 492 70 2 339 3 nagZ Beta-hexosaminidase Shigella boydii serotype 4 (strain Sb227)
B2U513 3.89e-175 492 70 2 339 3 nagZ Beta-hexosaminidase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YVX6 6.65e-175 491 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58067 6.65e-175 491 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O157:H7
Q8FIN2 7.66e-175 491 70 2 339 3 nagZ Beta-hexosaminidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3Z310 3.87e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Shigella sonnei (strain Ss046)
Q8ZQ06 4.09e-174 489 70 2 339 1 nagZ Beta-hexosaminidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TTH9 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella schwarzengrund (strain CVM19633)
A9N5J6 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3P6 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella newport (strain SL254)
B4TFI4 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella heidelberg (strain SL476)
B5RB93 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXC7 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella enteritidis PT4 (strain P125109)
B5FK98 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella dublin (strain CT_02021853)
Q57QE6 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella choleraesuis (strain SC-B67)
B5F8E5 4.09e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella agona (strain SL483)
Q8Z7I6 5.87e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella typhi
Q5PGT0 5.87e-174 489 70 2 339 3 nagZ Beta-hexosaminidase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5XXG4 3.16e-173 487 70 2 338 3 nagZ Beta-hexosaminidase Klebsiella pneumoniae (strain 342)
B7LT32 4.7e-173 486 69 2 339 3 nagZ Beta-hexosaminidase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VDM3 1.3e-171 483 70 2 336 3 nagZ Beta-hexosaminidase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DKR8 5.89e-171 481 68 2 337 3 nagZ Beta-hexosaminidase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D674 1.81e-169 478 67 2 337 3 nagZ Beta-hexosaminidase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BFM6 4.69e-158 449 66 2 338 3 nagZ Beta-hexosaminidase Edwardsiella ictaluri (strain 93-146)
Q6LJ30 2.01e-136 394 56 4 339 3 nagZ Beta-hexosaminidase Photobacterium profundum (strain SS9)
C3LSU7 1.69e-134 389 55 4 338 3 nagZ Beta-hexosaminidase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU37 1.69e-134 389 55 4 338 1 nagZ Beta-hexosaminidase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8Y1 5.99e-134 387 55 4 336 3 nagZ Beta-hexosaminidase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P96157 8.57e-134 387 58 4 332 1 nagZ Beta-hexosaminidase Vibrio furnissii
B8F5N0 1.56e-131 381 55 3 338 3 nagZ Beta-hexosaminidase Glaesserella parasuis serovar 5 (strain SH0165)
Q9CPH0 1.25e-127 372 51 4 345 3 nagZ Beta-hexosaminidase Pasteurella multocida (strain Pm70)
C4LEY6 1.9e-127 371 54 3 336 3 nagZ Beta-hexosaminidase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q0I414 2.78e-124 363 53 4 345 3 nagZ Beta-hexosaminidase Histophilus somni (strain 129Pt)
B0UTC6 3.23e-124 363 53 4 345 3 nagZ Beta-hexosaminidase Histophilus somni (strain 2336)
B0BQ51 5.08e-123 360 53 3 339 3 nagZ Beta-hexosaminidase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXZ7 2.58e-122 358 52 3 339 3 nagZ Beta-hexosaminidase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1B7 2.58e-122 358 52 3 339 3 nagZ Beta-hexosaminidase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VKU4 1.9e-121 356 50 4 346 3 nagZ Beta-hexosaminidase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1SW90 1.65e-119 351 52 4 339 3 nagZ Beta-hexosaminidase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q65VK7 2.06e-117 346 51 5 345 3 nagZ Beta-hexosaminidase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UDA9 1.15e-114 339 50 3 344 3 nagZ Beta-hexosaminidase Haemophilus influenzae (strain PittEE)
P44955 2.7e-114 338 49 3 344 3 nagZ Beta-hexosaminidase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QLU8 3.11e-114 338 50 3 344 3 nagZ Beta-hexosaminidase Haemophilus influenzae (strain 86-028NP)
Q7VNI8 2.63e-111 330 51 3 339 3 nagZ Beta-hexosaminidase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5QUZ5 3.25e-108 322 49 4 333 3 nagZ Beta-hexosaminidase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8GSD2 4.78e-106 317 51 8 340 3 nagZ Beta-hexosaminidase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0HJG7 6.38e-102 306 47 4 341 3 nagZ Beta-hexosaminidase Shewanella sp. (strain MR-4)
A0KXK3 1.35e-101 305 47 4 341 3 nagZ Beta-hexosaminidase Shewanella sp. (strain ANA-3)
Q0HVQ8 2.36e-100 302 47 4 341 3 nagZ Beta-hexosaminidase Shewanella sp. (strain MR-7)
Q9HZK0 6.03e-100 301 51 6 334 1 nagZ Beta-hexosaminidase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PG9 6.03e-100 301 51 6 334 3 nagZ Beta-hexosaminidase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYS5 6.03e-100 301 51 6 334 3 nagZ Beta-hexosaminidase Pseudomonas aeruginosa (strain LESB58)
Q8EEW2 3.04e-99 299 46 4 341 3 nagZ Beta-hexosaminidase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0A911 2.82e-98 297 47 5 335 3 nagZ Beta-hexosaminidase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1H075 4.9e-98 296 51 5 308 3 nagZ Beta-hexosaminidase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3J953 5.44e-97 293 49 8 343 3 nagZ Beta-hexosaminidase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7W9J5 4.54e-96 291 47 6 339 3 nagZ Beta-hexosaminidase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WH65 4.54e-96 291 47 6 339 3 nagZ Beta-hexosaminidase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2KXM7 1.3e-95 290 47 7 338 3 nagZ Beta-hexosaminidase Bordetella avium (strain 197N)
Q080R9 1.55e-94 287 45 4 329 3 nagZ Beta-hexosaminidase Shewanella frigidimarina (strain NCIMB 400)
Q7VWV8 1.44e-93 285 47 7 339 3 nagZ Beta-hexosaminidase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2Y863 1.81e-92 282 44 5 339 3 nagZ Beta-hexosaminidase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3SKU2 5.38e-91 279 47 7 340 3 nagZ Beta-hexosaminidase Thiobacillus denitrificans (strain ATCC 25259)
Q5P081 1.82e-89 275 47 7 342 3 nagZ Beta-hexosaminidase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9JVT3 3e-89 275 50 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q0AF74 1.64e-88 272 43 5 337 3 nagZ Beta-hexosaminidase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7NWB7 2.76e-88 272 47 5 330 3 nagZ Beta-hexosaminidase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q82SJ8 4.3e-87 268 44 5 339 3 nagZ Beta-hexosaminidase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q606N2 6.41e-87 268 45 6 339 3 nagZ Beta-hexosaminidase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B4RQ67 2.28e-86 267 49 4 284 3 nagZ Beta-hexosaminidase Neisseria gonorrhoeae (strain NCCP11945)
Q31G32 2.61e-86 267 45 7 331 3 nagZ Beta-hexosaminidase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A9M1Z4 7.53e-85 263 49 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup C (strain 053442)
Q5FA94 2.51e-84 262 49 5 285 1 nagZ Beta-hexosaminidase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9K0Q4 2.53e-84 262 49 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KSD9 5.83e-84 261 48 5 285 3 nagZ Beta-hexosaminidase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B2FPW9 2.34e-76 241 47 3 280 3 nagZ Beta-hexosaminidase Stenotrophomonas maltophilia (strain K279a)
B4SRK3 2.97e-76 240 46 3 280 3 nagZ Beta-hexosaminidase Stenotrophomonas maltophilia (strain R551-3)
Q3BVU6 1.72e-69 223 45 4 280 3 nagZ Beta-hexosaminidase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMU1 1.21e-68 221 45 4 280 3 nagZ Beta-hexosaminidase Xanthomonas axonopodis pv. citri (strain 306)
Q5H1Q0 2.34e-68 220 45 4 280 3 nagZ Beta-hexosaminidase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4L0 3.84e-68 219 45 4 280 3 nagZ Beta-hexosaminidase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q9PAZ0 8.87e-68 219 41 4 313 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain 9a5c)
Q8PB42 2.48e-67 217 43 3 280 3 nagZ Beta-hexosaminidase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RX17 2.48e-67 217 43 3 280 3 nagZ Beta-hexosaminidase Xanthomonas campestris pv. campestris (strain B100)
Q4USG7 2.48e-67 217 43 3 280 3 nagZ Beta-hexosaminidase Xanthomonas campestris pv. campestris (strain 8004)
Q87BR5 2.2e-65 213 42 3 280 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6G9 2.2e-65 213 42 3 280 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain M23)
B0U3L0 3.72e-64 209 40 4 313 3 nagZ Beta-hexosaminidase Xylella fastidiosa (strain M12)
P48823 1.15e-32 131 30 6 290 1 cht60 Beta-hexosaminidase A Pseudoalteromonas piscicida
P40406 1.63e-30 125 29 5 283 1 nagZ Beta-hexosaminidase Bacillus subtilis (strain 168)
D4AQ52 2.67e-22 99 31 10 286 1 ARB_06359 Uncharacterized secreted glycosyl hydrolase ARB_06359 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
L7N6B0 2.61e-18 88 32 12 261 1 lpqI Beta-hexosaminidase LpqI Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A0H3M1P5 8.47e-18 87 32 12 261 3 lpqI Beta-hexosaminidase LpqI Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7WUL3 8.83e-11 66 26 12 282 1 nag3 Beta-N-acetylglucosaminidase/beta-glucosidase Cellulomonas fimi
P27034 4.58e-09 61 27 4 155 3 cbg-1 Beta-glucosidase Rhizobium radiobacter
T2KMH0 8.65e-07 54 27 7 197 1 BN863_22130 Beta-xylosidase Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q2UFP8 4.87e-06 52 22 8 276 3 bglC Probable beta-glucosidase C Aspergillus oryzae (strain ATCC 42149 / RIB 40)
B8NGU6 5.45e-06 51 22 8 276 3 bglC Probable beta-glucosidase C Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
P07337 5.12e-05 48 26 3 154 3 None Beta-glucosidase Kluyveromyces marxianus
A1DFA8 0.000134 47 24 8 216 3 bglI Probable beta-glucosidase I Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
P33363 0.000165 47 28 8 177 3 bglX Periplasmic beta-glucosidase Escherichia coli (strain K12)
Q56078 0.000195 47 28 8 177 3 bglX Periplasmic beta-glucosidase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E7CY69 0.000211 47 24 8 215 1 apy Exo-alpha-(1->6)-L-arabinopyranosidase Bifidobacterium longum
A1DNN8 0.000216 47 25 8 225 3 bglJ Probable beta-glucosidase J Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q5BA18 0.000222 46 25 10 255 2 bglK Probable beta-glucosidase K Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4WLY1 0.000227 46 26 5 157 3 bglJ Probable beta-glucosidase J Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
B0Y8M8 0.000233 46 26 5 157 3 bglJ Probable beta-glucosidase J Aspergillus fumigatus (strain CBS 144.89 / FGSC A1163 / CEA10)
Q23892 0.000261 46 27 7 205 1 gluA Lysosomal beta glucosidase Dictyostelium discoideum
A5ABF5 0.000292 46 24 7 199 3 bglM Probable beta-glucosidase M Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A1CA51 0.000312 46 25 6 183 3 bglI Probable beta-glucosidase I Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q5BFG8 0.000494 45 24 7 224 1 bglB Beta-glucosidase B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q4WU49 0.001 44 23 7 219 3 bglI Probable beta-glucosidase I Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07455
Feature type CDS
Gene nagZ
Product beta-N-acetylhexosaminidase
Location 1560371 - 1561393 (strand: -1)
Length 1023 (nucleotides) / 340 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1954
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00933 Glycosyl hydrolase family 3 N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1472 Carbohydrate transport and metabolism (G) G Periplasmic beta-glucosidase and related glycosidases

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01207 beta-N-acetylhexosaminidase [EC:3.2.1.52] Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
beta-Lactam resistance		 -

Protein Sequence

MGPVMLDVEGYELDSEEREILRHPSVGGLILFARNFHDTAQLRELTRQIREATGDNRLVIAVDQEGGRVQRFKDGFTHLPAAQSFAQFNDLLTGAALAEDAGWLMAAEMIAMDIDISFAPVLDLGHGSAAIGTRAFHEDGEIAAQMAERFVRGMRNAGMSSTGKHFPGHGAVSADSHKETPRDDRDPALIRGKDMAIFREFIQRGLLDAVMPAHVIYTQIDDRPASGSPYWLKSVLRQQLGFDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRNGAVSILDNLPVITAQRIDKLYHRGKGYDLTELQRSDRWQQANKTLSALHEQWQEQA

Flanking regions ( +/- flanking 50bp)

CGCCGCTGATGACAGCGCTCGGGATCAGATAAATACAAAGGGGTATCGTCATGGGACCTGTAATGTTAGATGTTGAAGGGTATGAGCTGGACAGCGAAGAGCGCGAGATCCTGCGACACCCCTCTGTCGGCGGGCTGATTCTGTTCGCCCGCAATTTTCACGATACCGCGCAACTGCGTGAACTGACCCGGCAAATCCGCGAAGCAACCGGTGATAACCGTCTGGTCATTGCGGTTGATCAGGAGGGCGGGCGTGTTCAGCGCTTTAAAGACGGGTTTACGCATCTGCCTGCGGCGCAATCTTTTGCACAGTTTAATGACCTGCTGACCGGTGCGGCACTGGCAGAAGATGCCGGCTGGCTGATGGCAGCAGAAATGATCGCCATGGATATTGATATCAGCTTTGCGCCGGTGCTTGATTTGGGGCACGGCAGTGCAGCTATCGGTACGCGGGCGTTCCATGAAGACGGCGAAATCGCCGCACAAATGGCAGAGCGCTTTGTGCGCGGTATGCGCAATGCAGGAATGTCGAGTACCGGTAAGCATTTTCCGGGGCACGGCGCGGTCAGTGCGGATTCCCATAAAGAAACACCGCGTGATGACAGAGATCCTGCGCTTATCCGTGGTAAAGATATGGCAATTTTCCGCGAGTTTATTCAGCGCGGTCTGTTGGATGCCGTTATGCCCGCGCATGTTATTTATACACAGATTGATGACCGCCCGGCCAGCGGCTCGCCGTACTGGCTTAAATCTGTCCTGCGTCAGCAGCTCGGTTTTGATGGTGTTATTTTCTCAGATGACCTGTCCATGGAAGGGGCGGCGATTATGGGCAGTTATGCAGAGCGCGGGCAGGCTTCGCTGGATGCGGGCTGTGACATGATCCTGGTGTGTAATAACCGCAATGGGGCGGTATCAATCCTTGATAATTTGCCGGTTATCACGGCACAACGTATTGATAAGTTGTATCATCGCGGGAAAGGTTATGATTTAACTGAATTACAGCGCAGTGATCGCTGGCAGCAGGCAAACAAAACCTTATCCGCATTACATGAACAATGGCAGGAGCAAGCATGATTATTTACCTTCATGGATTTGATTCAACCAGCCCGGGCAATCATGAGAAA