Homologs in group_1946

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14610 FBDBKF_14610 95.6 Morganella morganii S1 pepT peptidase T
EHELCC_15415 EHELCC_15415 95.6 Morganella morganii S2 pepT peptidase T
NLDBIP_15945 NLDBIP_15945 95.6 Morganella morganii S4 pepT peptidase T
LHKJJB_15895 LHKJJB_15895 95.6 Morganella morganii S3 pepT peptidase T
HKOGLL_15015 HKOGLL_15015 95.6 Morganella morganii S5 pepT peptidase T
PMI_RS04330 PMI_RS04330 84.4 Proteus mirabilis HI4320 pepT peptidase T

Distribution of the homologs in the orthogroup group_1946

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1946

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JI59 0.0 678 76 0 405 3 pepT Peptidase T Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669P7 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLP0 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pestis (strain Pestoides F)
Q1CI51 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0M2 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFR0 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pestis
B2K719 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6R3 0.0 675 76 0 405 3 pepT Peptidase T Yersinia pestis bv. Antiqua (strain Antiqua)
A7FH54 0.0 674 76 0 405 3 pepT Peptidase T Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DFW1 0.0 668 74 0 409 3 pepT Peptidase T Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4E3 0.0 668 74 0 409 3 pepT Peptidase T Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BFN3 0.0 653 73 0 405 3 pepT Peptidase T Edwardsiella ictaluri (strain 93-146)
A8GDC2 0.0 649 73 0 405 3 pepT Peptidase T Serratia proteamaculans (strain 568)
B5XSP2 0.0 646 72 0 405 3 pepT Peptidase T Klebsiella pneumoniae (strain 342)
A8AHU0 0.0 637 73 0 405 3 pepT Peptidase T Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7ZKR7 0.0 637 71 0 405 3 pepT Peptidase T Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I9K6 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli (strain SE11)
Q3Z2Z2 0.0 636 71 0 405 3 pepT Peptidase T Shigella sonnei (strain Ss046)
Q32EY5 0.0 636 71 0 405 3 pepT Peptidase T Shigella dysenteriae serotype 1 (strain Sd197)
Q1RD26 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli (strain UTI89 / UPEC)
B7N3N7 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P65803 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AA21 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O1:K1 / APEC
B7MTQ8 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O81 (strain ED1a)
P65804 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O157:H7
B7MJB5 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQ36 0.0 636 71 0 405 3 pepT Peptidase T Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P29745 0.0 635 71 0 405 1 pepT Peptidase T Escherichia coli (strain K12)
B1XA37 0.0 635 71 0 405 3 pepT Peptidase T Escherichia coli (strain K12 / DH10B)
C4ZS67 0.0 635 71 0 405 3 pepT Peptidase T Escherichia coli (strain K12 / MC4100 / BW2952)
Q0TIU6 0.0 635 71 0 405 3 pepT Peptidase T Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83RR6 0.0 634 71 0 405 3 pepT Peptidase T Shigella flexneri
Q0T5R1 0.0 634 71 0 405 3 pepT Peptidase T Shigella flexneri serotype 5b (strain 8401)
B1IUE0 0.0 634 71 0 405 3 pepT Peptidase T Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ82 0.0 634 71 0 405 3 pepT Peptidase T Escherichia coli O9:H4 (strain HS)
Q31ZK3 0.0 633 71 0 405 3 pepT Peptidase T Shigella boydii serotype 4 (strain Sb227)
B2TZ80 0.0 633 71 0 405 3 pepT Peptidase T Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5QXA9 0.0 630 72 0 405 3 pepT Peptidase T Salmonella enteritidis PT4 (strain P125109)
B7LQ18 0.0 630 71 0 405 3 pepT Peptidase T Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P26311 0.0 630 72 0 405 1 pepT Peptidase T Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TTK0 0.0 630 72 0 405 3 pepT Peptidase T Salmonella schwarzengrund (strain CVM19633)
B4T3R6 0.0 630 72 0 405 3 pepT Peptidase T Salmonella newport (strain SL254)
B4TFK5 0.0 630 72 0 405 3 pepT Peptidase T Salmonella heidelberg (strain SL476)
B5FK77 0.0 630 71 0 405 3 pepT Peptidase T Salmonella dublin (strain CT_02021853)
B5F8C6 0.0 630 72 0 405 3 pepT Peptidase T Salmonella agona (strain SL483)
B5BAE8 0.0 629 71 0 405 3 pepT Peptidase T Salmonella paratyphi A (strain AKU_12601)
Q5PMK2 0.0 629 71 0 405 3 pepT Peptidase T Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RB75 0.0 628 71 0 405 3 pepT Peptidase T Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q57QC7 0.0 628 71 0 405 3 pepT Peptidase T Salmonella choleraesuis (strain SC-B67)
A9MG86 0.0 628 71 0 405 3 pepT Peptidase T Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C0Q764 0.0 625 71 0 405 3 pepT Peptidase T Salmonella paratyphi C (strain RKS4594)
Q8Z7H6 0.0 624 71 0 404 3 pepT Peptidase T Salmonella typhi
Q87GX2 0.0 514 61 2 406 3 pepT Peptidase T Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LR24 7.56e-179 507 60 2 406 3 pepT Peptidase T Photobacterium profundum (strain SS9)
Q7MDF5 1.67e-177 503 59 2 406 3 pepT Peptidase T Vibrio vulnificus (strain YJ016)
B7VSC8 5.79e-175 497 59 2 406 3 pepT Peptidase T Vibrio atlanticus (strain LGP32)
Q5E0X3 7.26e-175 497 59 2 410 3 pepT Peptidase T Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ER23 7.42e-175 497 58 2 410 3 pepT Peptidase T Aliivibrio salmonicida (strain LFI1238)
C3LUK2 1.01e-174 496 59 2 411 3 pepT Peptidase T Vibrio cholerae serotype O1 (strain M66-2)
A5EYJ8 1.01e-174 496 59 2 411 3 pepT Peptidase T Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KMY6 5.05e-173 492 59 2 411 3 pepT Peptidase T Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A8H6S3 1.27e-167 478 58 5 406 3 pepT Peptidase T Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TPD4 4.59e-165 472 57 5 406 3 pepT Peptidase T Shewanella halifaxensis (strain HAW-EB4)
Q9CP05 4.71e-161 462 55 0 401 3 pepT Peptidase T Pasteurella multocida (strain Pm70)
B8CWQ0 2.41e-160 460 55 3 407 3 pepT Peptidase T Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
A4SPD7 5.57e-160 459 55 5 408 3 pepT Peptidase T Aeromonas salmonicida (strain A449)
Q5KZ39 8.22e-160 459 55 4 406 3 pepT Peptidase T Geobacillus kaustophilus (strain HTA426)
B1KHS7 9.06e-159 456 54 6 412 3 pepT Peptidase T Shewanella woodyi (strain ATCC 51908 / MS32)
Q64WS4 6.08e-158 454 55 3 404 3 pepT Peptidase T Bacteroides fragilis (strain YCH46)
Q5LFT7 6.08e-158 454 55 3 404 3 pepT Peptidase T Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A4INW9 6.76e-158 454 54 3 403 3 pepT Peptidase T Geobacillus thermodenitrificans (strain NG80-2)
Q97LS8 4.35e-157 452 54 4 411 3 pepT Peptidase T Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A0KIP7 1.32e-156 451 55 5 408 3 pepT Peptidase T Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C5DAS5 2.98e-156 450 53 3 404 3 pepT Peptidase T Geobacillus sp. (strain WCH70)
Q4QK58 5.69e-156 449 54 0 404 3 pepT Peptidase T Haemophilus influenzae (strain 86-028NP)
P45172 1.03e-155 448 54 0 404 3 pepT Peptidase T Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89YZ7 1.15e-155 448 54 3 404 3 pepT Peptidase T Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A5UEI5 2.06e-155 447 54 0 404 3 pepT Peptidase T Haemophilus influenzae (strain PittGG)
A8FIY2 3.75e-154 444 53 4 407 3 pepT Peptidase T Bacillus pumilus (strain SAFR-032)
P55179 6.83e-154 444 54 3 403 3 pepT Peptidase T Bacillus subtilis (strain 168)
Q65D74 7.06e-154 444 53 3 404 3 pepT Peptidase T Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5UBV7 1.33e-153 443 54 0 404 3 pepT Peptidase T Haemophilus influenzae (strain PittEE)
A7ZAB2 1.58e-153 443 53 3 404 3 pepT Peptidase T Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8G0I7 5.02e-153 441 55 4 403 3 pepT Peptidase T Shewanella sediminis (strain HAW-EB3)
A0Q3I1 5.12e-153 441 53 3 405 3 pepT Peptidase T Clostridium novyi (strain NT)
Q8R922 1.27e-152 440 53 4 408 3 pepT Peptidase T Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B1IEF5 1.65e-152 440 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain Okra / Type B1)
A5HYY2 2.33e-152 440 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPG2 2.33e-152 440 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain ATCC 19397 / Type A)
A7GAK0 2.75e-152 439 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C1FSB0 2.81e-152 439 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain Kyoto / Type A2)
C3L049 3.65e-152 439 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain 657 / Type Ba4)
B1KV00 8.93e-152 438 52 3 407 3 pepT Peptidase T Clostridium botulinum (strain Loch Maree / Type A3)
Q92AM8 2.5e-151 437 53 3 404 3 pepT Peptidase T Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AJN4 6.53e-151 436 53 4 408 3 pepT Peptidase T Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A7GR91 3.78e-150 434 53 3 403 3 pepT Peptidase T Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5WK52 1.77e-149 432 52 4 408 3 pepT Peptidase T Shouchella clausii (strain KSM-K16)
C1KW79 2.31e-149 432 53 4 408 3 pepT Peptidase T Listeria monocytogenes serotype 4b (strain CLIP80459)
Q0TV42 2.4e-149 432 52 3 406 3 pepT Peptidase T Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q71YN8 3.99e-149 432 53 4 408 3 pepT Peptidase T Listeria monocytogenes serotype 4b (strain F2365)
Q0SWT9 5.68e-149 431 53 3 406 3 pepT Peptidase T Clostridium perfringens (strain SM101 / Type A)
B8DDX7 5.97e-149 431 53 4 408 3 pepT Peptidase T Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y6B1 1.54e-148 430 53 4 408 3 pepT Peptidase T Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A8ML45 7.25e-148 428 51 4 407 3 pepT Peptidase T Alkaliphilus oremlandii (strain OhILAs)
A6L8T2 9.27e-148 428 51 5 404 3 pepT Peptidase T Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q24VU3 1.72e-147 427 53 5 416 3 pepT Peptidase T Desulfitobacterium hafniense (strain Y51)
Q8XPD8 2.85e-147 427 52 3 406 3 pepT Peptidase T Clostridium perfringens (strain 13 / Type A)
B8G1J0 1.22e-146 425 52 5 416 3 pepT Peptidase T Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B7HDL9 2.2e-146 424 52 3 401 3 pepT Peptidase T Bacillus cereus (strain B4264)
A9VR36 2.33e-146 424 52 3 401 3 pepT Peptidase T Bacillus mycoides (strain KBAB4)
B1YFS8 2.49e-146 424 52 4 412 3 pepT Peptidase T Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B7ITJ6 6.01e-146 424 52 3 401 3 pepT Peptidase T Bacillus cereus (strain G9842)
B1HZ48 6.99e-146 423 52 3 403 3 pepT Peptidase T Lysinibacillus sphaericus (strain C3-41)
Q81A48 1.02e-145 423 52 3 401 3 pepT Peptidase T Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C1ENW4 6.91e-145 421 51 3 402 3 pepT Peptidase T Bacillus cereus (strain 03BB102)
A0RHB6 6.91e-145 421 51 3 402 3 pepT Peptidase T Bacillus thuringiensis (strain Al Hakam)
Q6HF68 1.14e-144 420 51 3 401 3 pepT Peptidase T Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q732Y5 1.18e-144 420 52 3 401 3 pepT Peptidase T Bacillus cereus (strain ATCC 10987 / NRS 248)
B7HKU6 1.39e-144 420 52 3 401 3 pepT Peptidase T Bacillus cereus (strain AH187)
Q636T5 1.41e-144 420 52 3 401 3 pepT Peptidase T Bacillus cereus (strain ZK / E33L)
B9IV41 1.95e-144 420 52 3 401 3 pepT Peptidase T Bacillus cereus (strain Q1)
B7JJ20 4.04e-144 419 51 3 402 3 pepT Peptidase T Bacillus cereus (strain AH820)
Q81WU4 7.86e-144 418 51 3 402 1 pepT Peptidase T Bacillus anthracis
C3L855 7.86e-144 418 51 3 402 3 pepT Peptidase T Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5E3 7.86e-144 418 51 3 402 3 pepT Peptidase T Bacillus anthracis (strain A0248)
C4L0I9 1.4e-142 415 52 4 401 3 pepT Peptidase T Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8CXN0 2.46e-142 414 50 4 405 3 pepT Peptidase T Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C0ZDI3 1.1e-140 410 51 3 403 3 pepT Peptidase T Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A9KT72 8.64e-140 408 49 4 410 3 pepT Peptidase T Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q6GIP8 2.16e-139 407 50 4 406 3 pepT Peptidase T Staphylococcus aureus (strain MRSA252)
B9EAD7 2.23e-139 407 50 4 402 3 pepT Peptidase T Macrococcus caseolyticus (strain JCSC5402)
P65806 1.29e-138 405 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain N315)
P65805 1.29e-138 405 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQU7 1.29e-138 405 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain JH9)
A6TZM2 1.29e-138 405 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain JH1)
A7WZN6 1.29e-138 405 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NXM6 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain MW2)
A8Z018 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain USA300 / TCH1516)
Q6GB87 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain MSSA476)
A6QF52 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain Newman)
Q5HHS7 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain COL)
Q2G064 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIP8 1.77e-138 404 50 4 403 3 pepT Peptidase T Staphylococcus aureus (strain USA300)
Q2YSI6 1.8e-137 402 49 4 403 3 pepT Peptidase T Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L4G8 6.63e-136 398 50 3 401 3 pepT Peptidase T Staphylococcus haemolyticus (strain JCSC1435)
B9DK09 3.55e-135 396 48 3 405 3 pepT Peptidase T Staphylococcus carnosus (strain TM300)
P58794 3.25e-134 394 49 4 404 3 pepT Peptidase T Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B9DU35 4.73e-134 393 49 5 404 3 pepT Peptidase T Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8CWX9 6.05e-133 390 50 5 402 3 pepT Peptidase T Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q49VU2 2.89e-131 386 49 3 400 3 pepT Peptidase T Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8E4E2 3.01e-131 386 49 6 403 3 pepT Peptidase T Streptococcus agalactiae serotype III (strain NEM316)
Q38X92 3.89e-131 386 47 5 406 3 pepT Peptidase T Latilactobacillus sakei subsp. sakei (strain 23K)
C0MGM6 4.87e-131 385 48 5 404 3 pepT Peptidase T Streptococcus equi subsp. zooepidemicus (strain H70)
C0M8H1 4.87e-131 385 48 5 404 3 pepT Peptidase T Streptococcus equi subsp. equi (strain 4047)
Q8DYT4 3.85e-130 383 49 6 403 3 pepT Peptidase T Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q1WTV4 7.75e-130 382 48 7 410 3 pepT Peptidase T Ligilactobacillus salivarius (strain UCC118)
Q5M465 7.82e-130 382 50 5 402 3 pepT Peptidase T Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZL2 7.82e-130 382 50 5 402 3 pepT Peptidase T Streptococcus thermophilus (strain CNRZ 1066)
Q03KI4 1.25e-129 382 50 5 402 3 pepT Peptidase T Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q3K0C3 2.25e-129 381 49 6 403 3 pepT Peptidase T Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8CPZ6 2.38e-129 381 48 4 405 3 pepT Peptidase T Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQY6 2.38e-129 381 48 4 405 3 pepT Peptidase T Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B2GC19 4.47e-129 380 49 5 405 3 pepT Peptidase T Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A2RF89 7.04e-129 380 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7C3 7.04e-129 380 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHK2 9.35e-129 380 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q48U99 1.24e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q8P1H9 1.49e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1JMF5 1.7e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCH7 1.7e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M12 (strain MGAS2096)
B5XKT3 2.11e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD01 2.41e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD00 2.41e-128 379 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A0F4 7.15e-128 377 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M1
Q5XCU7 8.89e-128 377 48 5 400 3 pepT Peptidase T Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q835J5 1.41e-127 377 50 6 408 3 pepT Peptidase T Enterococcus faecalis (strain ATCC 700802 / V583)
Q97R31 3.45e-125 370 49 4 399 3 pepT Peptidase T Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A3CNH0 6.35e-125 370 50 4 399 3 pepT Peptidase T Streptococcus sanguinis (strain SK36)
C1C6Y4 1.09e-124 369 49 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain 70585)
A8AXT3 1.78e-124 369 50 4 399 3 pepT Peptidase T Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
C1CK88 1.86e-124 369 49 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain P1031)
B1IBG7 1.88e-124 369 49 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain Hungary19A-6)
B2IPG2 7.18e-124 367 48 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain CGSP14)
Q02X44 1.68e-123 367 48 5 406 3 pepT Peptidase T Lactococcus lactis subsp. cremoris (strain SK11)
A2RMN0 1.68e-123 367 48 5 406 3 pepT Peptidase T Lactococcus lactis subsp. cremoris (strain MG1363)
Q76HM7 1.68e-123 367 48 5 406 1 pepT Peptidase T Lactococcus lactis subsp. cremoris
C1CRC4 1.71e-123 366 48 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain Taiwan19F-14)
Q8DQ05 2.35e-123 366 48 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04KS5 2.35e-123 366 48 4 399 3 pepT Peptidase T Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P0C2T7 2.43e-123 366 48 5 406 1 pepT Peptidase T Lactococcus lactis subsp. cremoris
C1CE02 2.92e-123 365 48 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain JJA)
Q84BV2 5.73e-123 365 47 5 406 1 pepT Peptidase T Lactococcus lactis subsp. hordniae
Q76HM5 5.8e-123 365 48 5 406 1 pepT Peptidase T Lactococcus lactis subsp. lactis
Q9CEM7 5.8e-123 365 48 5 406 3 pepT Peptidase T Lactococcus lactis subsp. lactis (strain IL1403)
A4VVF5 2.07e-122 363 47 4 400 3 pepT Peptidase T Streptococcus suis (strain 05ZYH33)
A4W1Q9 2.07e-122 363 47 4 400 3 pepT Peptidase T Streptococcus suis (strain 98HAH33)
B8ZPG1 4.19e-122 363 48 4 399 3 pepT Peptidase T Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q9L4G1 4.55e-117 350 44 6 406 1 pepT Peptidase T Lactobacillus helveticus
Q8ZH96 1.39e-89 280 38 8 407 3 YPO1009 Peptidase T-like protein YPO1009/y3403/YP_3421 Yersinia pestis
Q92VT5 1.7e-86 271 37 6 408 3 RB0614 Peptidase T-like protein RB0614 Rhizobium meliloti (strain 1021)
P54542 1.41e-20 95 25 11 415 3 yqjE Uncharacterized protein YqjE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07405
Feature type CDS
Gene pepT
Product peptidase T
Location 1546345 - 1547580 (strand: -1)
Length 1236 (nucleotides) / 411 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1946
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01546 Peptidase family M20/M25/M40
PF07687 Peptidase dimerisation domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2195 Amino acid transport and metabolism (E) E Di- or tripeptidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01258 tripeptide aminopeptidase [EC:3.4.11.4] - -

Protein Sequence

MDKLLERFFGYVSFDTQSKPSGKLTPSSDGQFRLARALEKELKTLGLEDVSLDDKGCVMASLPSNVDWQVPVIGFISHLDTSPDFSGRNVNPQVLENYRGGDIALGIGDEVLSPVMFPVLHTMLGKTLIMTDGKTLLGADDKAGIAEIITAMVRLKNSDIPHGDIRIGFTPDEEIGRGAQHVDLKKFGAQWAYTVDGGGVGELEYENFNAAAVSIRIEGNNVHPGSAKGVMVNALSLATRIHNELPPEETPEHTEGYEGFYHLQSIKGTVERAEMNYIIRDFDRNNFEKRKNNMIVIAEKIGSGLHPDCYIELTIDDSYYNMRDHVVKHPHVIELAKQAMIDCDIKPDIKPIRGGTDGAQLSYRGLPCPNLFTGGYNFHSKHEFISLEGMEQAVSVIMRIAELTALDMKNK

Flanking regions ( +/- flanking 50bp)

TCAATCTATGTTTCCCTGATAATAAGAAAACAAAGTTATCGGGGGAACTCATGGATAAGTTATTAGAGCGCTTTTTCGGGTATGTCTCGTTTGACACCCAGTCTAAGCCTTCAGGCAAATTGACACCCAGCAGTGACGGTCAATTCAGGTTGGCGCGTGCTCTGGAAAAAGAACTGAAAACGCTGGGACTTGAAGATGTCTCGCTGGATGATAAAGGCTGTGTGATGGCCTCATTACCATCAAATGTTGACTGGCAGGTGCCGGTTATCGGTTTTATATCCCACCTTGATACATCACCGGATTTCTCCGGGCGTAATGTGAACCCTCAGGTTCTGGAAAACTACCGTGGCGGAGATATCGCACTCGGTATCGGTGATGAAGTACTGTCTCCGGTGATGTTCCCGGTTCTGCATACCATGCTGGGTAAAACCCTGATCATGACGGATGGTAAAACCCTGCTCGGCGCGGATGATAAAGCAGGTATTGCGGAAATTATCACCGCAATGGTCCGCCTGAAAAACAGCGATATTCCACACGGTGATATCCGCATCGGCTTCACGCCGGATGAAGAAATCGGGCGTGGTGCTCAGCATGTGGATCTGAAAAAATTCGGCGCTCAGTGGGCATATACCGTGGATGGCGGTGGTGTTGGTGAGCTGGAATATGAAAACTTTAATGCGGCGGCTGTGTCTATCCGTATTGAGGGGAACAATGTTCATCCCGGCAGTGCCAAAGGGGTGATGGTCAATGCGCTCTCGCTGGCAACCCGTATTCATAATGAATTACCGCCGGAAGAAACCCCTGAACATACTGAGGGTTATGAAGGTTTTTATCATCTGCAAAGTATCAAAGGCACGGTTGAACGCGCTGAGATGAATTATATCATCCGGGACTTTGATCGTAATAACTTTGAAAAACGCAAAAATAATATGATTGTCATTGCTGAAAAAATCGGCAGCGGGTTGCATCCTGACTGTTATATTGAGCTGACCATCGACGACAGTTATTACAATATGCGCGACCATGTGGTGAAACATCCGCACGTCATTGAACTCGCCAAACAGGCAATGATTGACTGTGATATTAAACCGGATATCAAACCTATCCGTGGCGGTACTGATGGCGCACAGCTCTCTTACCGTGGCTTACCCTGCCCGAATTTATTTACCGGCGGCTATAACTTCCACAGTAAACACGAGTTTATTTCGCTGGAAGGTATGGAACAGGCGGTATCCGTTATTATGCGGATTGCCGAATTAACCGCGTTGGATATGAAGAATAAATAAGTTAAATTTTATATCTAAATGGTCGATCAATAAGCCACCTGAATACAGGT