Homologs in group_2509

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00940 FBDBKF_00940 93.9 Morganella morganii S1 rhtB Threonine/homoserine/homoserine lactone efflux protein
EHELCC_00605 EHELCC_00605 93.9 Morganella morganii S2 rhtB Threonine/homoserine/homoserine lactone efflux protein
NLDBIP_02855 NLDBIP_02855 93.9 Morganella morganii S4 rhtB Threonine/homoserine/homoserine lactone efflux protein
LHKJJB_04370 LHKJJB_04370 93.9 Morganella morganii S3 rhtB Threonine/homoserine/homoserine lactone efflux protein
HKOGLL_02675 HKOGLL_02675 93.9 Morganella morganii S5 rhtB Threonine/homoserine/homoserine lactone efflux protein

Distribution of the homologs in the orthogroup group_2509

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2509

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1RAZ2 3.75e-34 124 34 5 211 3 leuE Leucine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FGV4 3.75e-34 124 34 5 211 3 leuE Leucine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH31 3.75e-34 124 34 5 211 3 leuE Leucine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABX2 3.75e-34 124 34 5 211 3 leuE Leucine efflux protein Escherichia coli O1:K1 / APEC
P76249 3.83e-34 124 33 4 210 1 leuE Leucine efflux protein Escherichia coli (strain K12)
A8A0Z3 3.83e-34 124 33 4 210 3 leuE Leucine efflux protein Escherichia coli O9:H4 (strain HS)
Q8XDS6 5.4e-34 123 33 4 210 3 leuE Leucine efflux protein Escherichia coli O157:H7
Q3Z2D8 1.04e-33 122 33 4 210 3 leuE Leucine efflux protein Shigella sonnei (strain Ss046)
A7ZMR9 1.04e-33 122 33 4 210 3 leuE Leucine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32FT6 1.6e-33 122 33 4 210 3 leuE Leucine efflux protein Shigella dysenteriae serotype 1 (strain Sd197)
Q7CQP8 5.22e-32 118 32 4 210 3 leuE Leucine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV9 5.22e-32 118 32 4 210 3 leuE Leucine efflux protein Salmonella typhi
Q5PHF4 5.22e-32 118 32 4 210 3 leuE Leucine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57Q25 5.22e-32 118 32 4 210 3 leuE Leucine efflux protein Salmonella choleraesuis (strain SC-B67)
A8AHJ0 1.7e-31 117 32 3 210 3 leuE Leucine efflux protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q321T8 2.22e-31 116 33 4 195 5 leuE Putative leucine efflux protein Shigella boydii serotype 4 (strain Sb227)
A6T7N0 1.66e-30 114 32 4 211 3 leuE Leucine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A4WB82 6.41e-29 110 32 4 212 3 leuE Leucine efflux protein Enterobacter sp. (strain 638)
P38102 6.85e-21 89 31 4 217 3 PA4757 Uncharacterized membrane protein PA4757 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KVK7 1.12e-20 89 27 3 210 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0AG37 3.85e-17 79 27 3 202 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 3.85e-17 79 27 3 202 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 3.85e-17 79 27 3 202 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 3.85e-17 79 27 3 202 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
O05406 1.33e-16 78 28 4 199 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
Q9L6N6 7.98e-16 75 28 3 191 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75693 1.99e-15 75 30 4 155 3 yahN Uncharacterized membrane protein YahN Escherichia coli (strain K12)
Q8Z3B3 2.62e-15 74 28 4 198 3 rhtC Threonine efflux protein Salmonella typhi
Q9L6N7 2.79e-15 74 28 4 198 3 rhtC Threonine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3B4 4.12e-15 73 28 3 191 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
P0AG38 2.42e-14 72 27 3 193 1 rhtC Threonine efflux protein Escherichia coli (strain K12)
P0AG39 2.42e-14 72 27 3 193 3 rhtC Threonine efflux protein Escherichia coli O157:H7
Q57320 1.04e-12 67 28 3 191 3 HI_1307 Uncharacterized membrane protein HI_1307 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P74343 3.75e-08 55 25 1 141 3 slr1627 Uncharacterized membrane protein slr1627 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06935
Feature type CDS
Gene -
Product LysE family translocator
Location 1438613 - 1439257 (strand: 1)
Length 645 (nucleotides) / 214 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2509
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05834 homoserine/homoserine lactone efflux protein - -

Protein Sequence

MLDIIHYPLFLVSVFIFAVTPGPDIAYVLGQSLANGRKAGILSALGVMLGSSVHAIAGAIGLGAIIAASPTLFTVIKYLGAVYLAFLGAKMIWGTLKKRGQTGEDEEVVIQKAAAKTILIRGFITTLTNPKVLLFFIAFFPQFIAADGGHYAESFLLLGATYALLGFCTDLTLALIAGTLAARISGSPKAHYWIDRVVGTTFIALGLRLASVAR

Flanking regions ( +/- flanking 50bp)

ATTATGTCAGACACTATTTAACCTTGATGTCAGTCACGAGGAATGCTCACATGCTGGATATTATCCATTACCCCCTGTTTTTGGTGTCTGTTTTTATTTTTGCCGTCACCCCGGGGCCGGATATTGCCTATGTGCTGGGACAAAGTCTGGCGAACGGGCGCAAAGCCGGGATACTTTCCGCTCTGGGGGTGATGCTCGGCAGCAGTGTACACGCCATCGCCGGTGCCATCGGGCTGGGGGCAATCATTGCCGCCTCACCGACTTTATTCACTGTGATTAAATACCTGGGGGCGGTGTATCTTGCTTTTCTCGGGGCAAAAATGATTTGGGGAACACTGAAAAAACGGGGGCAAACCGGGGAAGATGAAGAGGTTGTCATTCAGAAAGCGGCAGCAAAAACGATTCTGATCCGTGGCTTTATTACCACACTGACCAACCCGAAAGTCCTGCTGTTTTTTATTGCCTTTTTCCCGCAGTTTATTGCCGCAGACGGCGGCCATTATGCAGAGTCGTTTCTGTTGCTCGGCGCAACTTATGCGCTGCTCGGATTCTGTACTGACCTCACACTGGCGCTGATTGCCGGTACGCTGGCTGCCCGGATTTCAGGCAGCCCGAAAGCACATTACTGGATAGACAGAGTGGTCGGTACCACTTTTATTGCGCTGGGACTGCGCCTGGCATCAGTGGCACGCTGAAAACTCAGCCGGAAACAGCCGTATCAAGGTGTGCAAGATAACGGCTGATG