Homologs in group_494

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00895 FBDBKF_00895 95.1 Morganella morganii S1 ttrB tetrathionate reductase subunit TtrB
EHELCC_00650 EHELCC_00650 95.1 Morganella morganii S2 ttrB tetrathionate reductase subunit TtrB
NLDBIP_02810 NLDBIP_02810 95.1 Morganella morganii S4 ttrB tetrathionate reductase subunit TtrB
LHKJJB_04325 LHKJJB_04325 95.1 Morganella morganii S3 ttrB tetrathionate reductase subunit TtrB
HKOGLL_02720 HKOGLL_02720 95.1 Morganella morganii S5 ttrB tetrathionate reductase subunit TtrB
PMI_RS08235 PMI_RS08235 83.3 Proteus mirabilis HI4320 ttrB tetrathionate reductase subunit TtrB

Distribution of the homologs in the orthogroup group_494

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_494

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQM9 1.11e-148 417 81 1 245 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O30080 7.77e-51 167 42 4 191 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9HR73 1.15e-47 161 40 6 220 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O29751 1.43e-41 145 34 6 267 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q7WTT9 6.56e-40 140 34 3 229 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P0A1I1 1.59e-39 138 44 5 169 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 1.59e-39 138 44 5 169 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P45015 2.12e-39 139 37 7 225 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P31076 8.38e-39 136 40 4 186 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P0AAK9 9.24e-39 137 38 6 223 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 9.24e-39 137 38 6 223 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 9.24e-39 137 38 6 223 3 nrfC Protein NrfC Escherichia coli O157:H7
D3RNN7 2.8e-37 134 38 5 201 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
Q8X616 3.74e-36 130 37 4 193 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
P77375 9.39e-36 129 37 4 193 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8GPG3 2.83e-33 125 44 2 139 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
P60069 7.02e-33 124 41 2 154 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
Q9S1G9 1.83e-32 123 42 2 145 1 serB Selenate reductase subunit beta Thauera selenatis
I3R9M8 2.5e-30 118 42 3 136 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q47CW7 2.86e-30 118 38 2 159 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
Q72E85 9.18e-29 112 31 7 227 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q83RZ7 2.47e-26 104 40 4 145 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P18776 2.47e-26 104 40 4 145 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
P0AAJ1 2.86e-26 104 40 4 145 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 2.86e-26 104 40 4 145 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42176 2.76e-25 106 36 2 169 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
P80564 1.78e-22 96 31 6 195 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
P11349 2.56e-22 98 42 1 108 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q83RN5 2.71e-22 98 42 1 108 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P19318 4.56e-22 97 41 1 109 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
P27273 5.88e-22 92 33 6 196 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P0AAJ4 1.03e-20 91 26 4 231 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.03e-20 91 26 4 231 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P33389 1.09e-20 92 34 4 164 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P0AAJ7 3.28e-20 90 28 2 186 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 3.28e-20 90 28 2 186 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 3.28e-20 90 28 2 186 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45003 5.65e-20 87 33 4 145 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44450 7.73e-19 87 32 4 178 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P56256 1.36e-18 82 37 6 138 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P0AAK0 2.98e-18 85 31 8 222 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 2.98e-18 85 31 8 222 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 2.98e-18 85 31 8 222 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
Q46819 1.99e-15 74 33 5 141 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P85098 2.78e-15 76 31 6 162 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P0AAL8 2.63e-14 72 26 7 209 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 2.63e-14 72 26 7 209 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 2.63e-14 72 26 7 209 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q57619 2.93e-14 71 36 5 119 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8GC87 9.19e-14 71 30 6 190 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
P0AAK4 1.1e-13 70 30 4 158 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 1.1e-13 70 30 4 158 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 1.1e-13 70 30 4 158 3 hydN Electron transport protein HydN Escherichia coli O157:H7
Q46820 3.94e-13 72 32 5 128 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P31894 6.56e-12 65 29 4 149 1 cooF Iron-sulfur protein Rhodospirillum rubrum
Q8L3A9 9.42e-11 64 30 4 139 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
P37127 2.34e-10 63 30 5 141 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
P0AAK3 2.48e-10 61 33 3 102 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 2.48e-10 61 33 3 102 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 2.48e-10 61 33 3 102 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23481 4.32e-10 60 35 3 95 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
Q727P4 3.28e-09 58 25 4 180 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q57713 3.62e-09 57 38 3 83 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P20925 1.72e-08 55 30 3 126 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
Q57712 2.05e-06 49 28 5 138 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q00388 2.92e-05 48 31 4 98 4 vhuB Polyferredoxin protein VhuB Methanococcus voltae
Q58567 0.001 40 32 3 84 4 fwdG Polyferredoxin protein FwdG Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06890
Feature type CDS
Gene ttrB
Product tetrathionate reductase subunit TtrB
Location 1427951 - 1428691 (strand: -1)
Length 741 (nucleotides) / 246 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_494
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08358 tetrathionate reductase subunit B Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system		 -

Protein Sequence

MDLGKRKFLQNLGVLTAGASLVPLAEAGMHFSPTRREGDPSKRYAMLIDLRRCVGCQSCTVSCSVENQSPQGQFRTSVSQYQIQIRNEDAATTNVLLPRLCNHCDNPPCVPVCPVQATFQREDGIVVVDNTRCVGCAYCVQACPYDARFINHSTQTADKCTFCTHRLEAGLLPACVESCVGGARIIGDLKDPSSTISKMLHEHEAAIKVLKPESGTLPQVFYLGLDDAFVQPLENRGQPALWQEIH

Flanking regions ( +/- flanking 50bp)

TGAGTTTGAACATTAAGCGCAATGAAGTTTGAAAGACACTGGAGAGCAGTATGGATCTTGGCAAACGAAAATTTCTGCAAAATCTGGGAGTCCTGACCGCCGGGGCTTCACTGGTTCCGCTGGCGGAAGCCGGTATGCATTTTTCACCGACCCGTCGTGAAGGTGACCCGTCAAAACGTTACGCAATGCTGATTGATTTACGCCGCTGTGTCGGCTGTCAGTCATGTACCGTCAGTTGTTCCGTAGAAAATCAGAGCCCGCAGGGGCAATTCCGCACATCCGTCAGTCAGTATCAGATCCAGATCCGCAATGAGGATGCCGCAACAACTAACGTCCTGCTGCCGCGCCTGTGCAATCACTGTGATAATCCGCCATGTGTGCCGGTGTGTCCGGTGCAGGCGACGTTCCAGCGTGAAGACGGAATTGTGGTGGTGGATAACACCCGCTGCGTGGGCTGCGCATACTGTGTGCAGGCCTGTCCGTACGATGCCCGCTTTATTAACCACAGTACACAAACGGCGGATAAGTGCACGTTCTGTACCCACCGTCTGGAAGCCGGGTTGTTACCGGCCTGTGTGGAATCCTGTGTCGGCGGTGCGCGTATCATCGGCGATTTAAAAGATCCGTCCAGCACAATAAGCAAAATGCTGCATGAACACGAAGCCGCAATCAAAGTTCTGAAACCGGAAAGCGGCACATTACCGCAGGTGTTTTATCTGGGGCTGGATGATGCCTTTGTCCAACCGCTGGAAAATCGCGGTCAGCCCGCATTATGGCAGGAGATCCACTGATGATTGAACAGACAATGTTAATTCAGGAAGTGCTGGCCCGCCCGCAGGAA