Homologs in group_563

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00805 FBDBKF_00805 96.3 Morganella morganii S1 motA flagellar motor stator protein MotA
EHELCC_00740 EHELCC_00740 96.3 Morganella morganii S2 motA flagellar motor stator protein MotA
NLDBIP_02720 NLDBIP_02720 96.3 Morganella morganii S4 motA flagellar motor stator protein MotA
LHKJJB_04235 LHKJJB_04235 96.3 Morganella morganii S3 motA flagellar motor stator protein MotA
HKOGLL_02810 HKOGLL_02810 96.3 Morganella morganii S5 motA flagellar motor stator protein MotA
PMI_RS08155 PMI_RS08155 67.5 Proteus mirabilis HI4320 motA flagellar motor stator protein MotA

Distribution of the homologs in the orthogroup group_563

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_563

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P55891 7.85e-144 409 65 0 294 3 motA Motility protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P09348 2.31e-139 397 64 0 294 1 motA Motility protein A Escherichia coli (strain K12)
Q44456 5.81e-71 224 40 0 280 3 motA Motility protein A Agrobacterium fabrum (strain C58 / ATCC 33970)
P97215 1.22e-59 194 38 0 280 3 motA Motility protein A Rhizobium meliloti (strain 1021)
Q03477 6.49e-55 182 33 0 279 2 lafT Chemotaxis protein LafT Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P28611 1.69e-20 92 29 7 275 1 motA Motility protein A Bacillus subtilis (strain 168)
O07886 3.51e-13 71 25 5 252 3 motA Motility protein A Treponema pallidum (strain Nichols)
P46826 1.18e-12 70 25 5 284 3 ytxD Uncharacterized 29.3 kDa protein in ccpA 3'region Priestia megaterium
Q56331 2.51e-10 63 23 5 253 3 motA Motility protein A Treponema phagedenis
O67122 3.27e-09 59 25 7 174 1 motA Motility protein A Aquifex aeolicus (strain VF5)
Q44902 1.5e-06 52 20 7 264 3 motA Motility protein A Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
P65410 2.95e-05 48 24 7 233 3 motA Motility protein A Helicobacter pylori (strain ATCC 700392 / 26695)
P65411 2.95e-05 48 24 7 233 3 motA Motility protein A Helicobacter pylori (strain J99 / ATCC 700824)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06805
Feature type CDS
Gene motA
Product flagellar motor stator protein MotA
Location 1413498 - 1414385 (strand: -1)
Length 888 (nucleotides) / 295 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_563
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01618 MotA/TolQ/ExbB proton channel family
PF20560 Motility protein A N-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1291 Cell motility (N) N Flagellar motor component MotA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02556 chemotaxis protein MotA Two-component system
Bacterial chemotaxis
Flagellar assembly		 -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043213 flagellar motor protein MotA VF0394 Motility

Protein Sequence

MLILIGYIIVTGTVIGGYLMVGGHMGALYQPAEFLIILGAGFGAFVVGNSGKSIIALGKVLPRLFRRSAYNKTMSMDLMALLFQLLNKSRQQGLLALEKDIENPQESDIFSQYPRVLKDPVALMFLVDYLRLMITSNLQSHEIEALMEEELETFRQESEVPASGLNMVGDSMPAFGIVAAVLGVVNALASADRPAGELGALIAHAMVGTFLGILVAYGFILPLASLIRLRSGEQLKMLECIKVTFLSSLQGYPPQIAVEFGRKVLFSTDRPSFTELEDKVREVKVSHRTEAKDEE

Flanking regions ( +/- flanking 50bp)

AAACTCCCTTTGACTGCCATCCGATACCTAACTGAGTGAAAGGGAATAGCGTGTTAATACTCATTGGATACATCATTGTTACGGGCACGGTCATCGGCGGATATCTGATGGTCGGCGGTCATATGGGCGCACTTTACCAACCCGCAGAGTTTCTGATTATTTTAGGCGCCGGTTTTGGTGCGTTTGTCGTTGGTAACAGCGGAAAATCCATTATTGCCCTGGGTAAAGTCCTGCCACGCCTGTTCCGGCGCTCGGCTTACAACAAAACTATGTCAATGGATCTGATGGCACTTTTGTTTCAGCTTCTGAACAAATCCCGCCAGCAGGGGCTTTTGGCACTGGAAAAAGATATCGAAAATCCGCAGGAGAGCGATATCTTTTCCCAGTATCCCCGCGTTCTGAAAGATCCCGTTGCGTTGATGTTCCTTGTTGATTATCTGCGCCTGATGATTACCAGTAACCTGCAAAGTCATGAAATTGAAGCGTTGATGGAAGAAGAGCTGGAAACGTTCCGCCAGGAGAGTGAAGTCCCTGCATCCGGTCTGAATATGGTAGGTGATTCCATGCCGGCATTCGGTATTGTTGCCGCGGTTCTCGGTGTGGTCAATGCTCTGGCCTCAGCCGATCGCCCTGCCGGTGAGCTGGGCGCACTGATTGCTCACGCGATGGTCGGAACATTCCTCGGGATACTTGTGGCTTACGGCTTTATTTTACCGCTGGCCTCACTTATCCGTCTGCGCAGCGGCGAGCAATTAAAAATGCTGGAATGCATTAAGGTGACGTTTCTCTCTTCACTTCAGGGTTATCCTCCGCAAATTGCTGTCGAATTCGGTCGTAAAGTACTGTTCAGCACTGATCGTCCGTCATTTACCGAGCTGGAAGATAAAGTCCGCGAGGTGAAAGTCAGTCACCGCACCGAAGCGAAGGACGAGGAGTAATCAGACAATGAAACCGGGCAATACGCAGATTATCCGCGTCAAAAAGCGGG