Homologs in group_2746

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07415 FBDBKF_07415 93.3 Morganella morganii S1 tusA Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)
EHELCC_03555 EHELCC_03555 93.3 Morganella morganii S2 tusA Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)
NLDBIP_03555 NLDBIP_03555 93.3 Morganella morganii S4 tusA Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)
LHKJJB_09385 LHKJJB_09385 93.3 Morganella morganii S3 tusA Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)
HKOGLL_09590 HKOGLL_09590 93.3 Morganella morganii S5 tusA Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)

Distribution of the homologs in the orthogroup group_2746

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2746

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P33014 1.05e-26 95 54 0 75 1 tsuB Putative sulfur carrier protein TsuB Escherichia coli (strain K12)
O29697 1.01e-14 65 37 0 69 3 AF_0554 Putative sulfur carrier protein AF_0554 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9X078 2.72e-14 64 36 0 71 1 TM_0983 Putative sulfur carrier protein TM_0983 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P0AA36 6.46e-08 47 36 0 60 3 yedF Putative sulfur carrier protein YedF Shigella flexneri
P0AA34 6.46e-08 47 36 0 60 3 yedF Putative sulfur carrier protein YedF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA35 6.46e-08 47 36 0 60 3 yedF Putative sulfur carrier protein YedF Salmonella typhi
P0AA31 6.46e-08 47 36 0 60 1 yedF Putative sulfur carrier protein YedF Escherichia coli (strain K12)
P0AA32 6.46e-08 47 36 0 60 3 yedF Putative sulfur carrier protein YedF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA33 6.46e-08 47 36 0 60 3 yedF Putative sulfur carrier protein YedF Escherichia coli O157:H7
P54436 1.28e-06 44 32 1 70 3 yrkI Putative sulfur carrier protein YrkI Bacillus subtilis (strain 168)
O30050 1.31e-06 44 28 0 69 3 AF_0188 Putative sulfur carrier protein AF_0188 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O54608 8.64e-06 42 32 2 73 3 VNG_5061C Putative sulfur carrier protein VNG_5061C/VNG_5236C/VNG_6059C/VNG_6467C Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B6EGT6 1.29e-05 42 31 1 73 3 tusA Sulfur carrier protein TusA Aliivibrio salmonicida (strain LFI1238)
Q58397 1.56e-05 42 37 1 70 3 MJ0990 Putative sulfur carrier protein MJ0990 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q7MQI4 2.36e-05 41 29 1 75 3 tusA Sulfur carrier protein TusA Vibrio vulnificus (strain YJ016)
Q8DDK1 2.36e-05 41 29 1 75 3 tusA Sulfur carrier protein TusA Vibrio vulnificus (strain CMCP6)
P54433 2.88e-05 42 31 0 63 3 yrkF Putative sulfur carrier protein YrkF Bacillus subtilis (strain 168)
O29695 3.6e-05 40 28 1 69 3 AF_0556 Putative sulfur carrier protein AF_0556 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P67102 6.96e-05 40 32 0 59 3 NMA0882 Putative sulfur carrier protein NMA0882 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P67103 6.96e-05 40 32 0 59 3 NMB0681 Putative sulfur carrier protein NMB0681 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
C3LP97 0.000105 39 30 1 73 3 tusA Sulfur carrier protein TusA Vibrio cholerae serotype O1 (strain M66-2)
Q9KVW4 0.000105 39 30 1 73 3 tusA Sulfur carrier protein TusA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4A1 0.000105 39 30 1 73 3 tusA Sulfur carrier protein TusA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B3GZT1 0.000114 39 30 1 70 3 tusA Sulfur carrier protein TusA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9CKV9 0.000144 39 33 2 75 3 tusA Sulfur carrier protein TusA Pasteurella multocida (strain Pm70)
Q3IJ25 0.000189 39 31 2 73 3 tusA Sulfur carrier protein TusA Pseudoalteromonas translucida (strain TAC 125)
A4STF8 0.000197 39 28 1 73 3 tusA Sulfur carrier protein TusA Aeromonas salmonicida (strain A449)
A7N1E2 0.000246 38 28 1 75 3 tusA Sulfur carrier protein TusA Vibrio campbellii (strain ATCC BAA-1116)
A0KEK5 0.000249 38 28 1 73 3 tusA Sulfur carrier protein TusA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B5FEW3 0.000279 38 28 1 73 3 tusA Sulfur carrier protein TusA Aliivibrio fischeri (strain MJ11)
Q5E8Y2 0.000279 38 28 1 73 3 tusA Sulfur carrier protein TusA Aliivibrio fischeri (strain ATCC 700601 / ES114)
B7VGL0 0.000301 38 27 2 79 3 tusA Sulfur carrier protein TusA Vibrio atlanticus (strain LGP32)
Q87TP4 0.000309 38 28 1 75 3 tusA Sulfur carrier protein TusA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5UE04 0.000311 38 31 1 73 3 tusA Sulfur carrier protein TusA Haemophilus influenzae (strain PittEE)
P44841 0.000324 38 31 1 73 3 tusA Sulfur carrier protein TusA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D3RPC0 0.000405 38 27 1 70 1 tusA Sulfur carrier protein TusA Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
A4WFQ2 0.000414 38 27 1 70 3 tusA Sulfur carrier protein TusA Enterobacter sp. (strain 638)
B8F8H4 0.000663 37 30 1 70 3 tusA Sulfur carrier protein TusA Glaesserella parasuis serovar 5 (strain SH0165)
P44593 0.000858 37 27 0 70 3 HI_0242 Putative sulfur carrier protein HI_0242 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06490
Feature type CDS
Gene -
Product sulfurtransferase TusA family protein
Location 1351637 - 1351864 (strand: -1)
Length 228 (nucleotides) / 75 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2746
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01206 Sulfurtransferase TusA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0425 Translation, ribosomal structure and biogenesis (J)
Coenzyme transport and metabolism (H)
Posttranslational modification, protein turnover, chaperones (O)
JHO Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04085 tRNA 2-thiouridine synthesizing protein A [EC:2.8.1.-] Sulfur relay system -

Protein Sequence

MNTLELDTRGHLCPFPLIEAKKAIETLSTGDLLVIKYDCAQATENIPRWAAEAGHDVTDFEQIGDAQWKMAIKKG

Flanking regions ( +/- flanking 50bp)

TTTTACGATTATCCGTCCTCAGAAAATAAAGTAATTAATAAGGTGAAACTATGAATACGCTGGAATTAGATACCCGCGGGCATTTGTGTCCGTTCCCGTTAATTGAAGCTAAAAAAGCCATTGAAACATTATCAACCGGTGATTTACTGGTTATTAAATATGATTGTGCGCAGGCAACTGAAAATATTCCGCGCTGGGCGGCTGAAGCGGGGCATGATGTTACTGATTTTGAACAAATCGGTGATGCACAATGGAAAATGGCAATTAAAAAAGGCTGAAAAAGCCCGGAAAAAATGGCGGCATAATAAATATAAAGATATGCCGTTAA