Homologs in group_3377

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12370 FBDBKF_12370 40.7 Morganella morganii S1 rusA Crossover junction endodeoxyribonuclease RusA
EHELCC_19125 EHELCC_19125 41.5 Morganella morganii S2 rusA Crossover junction endodeoxyribonuclease RusA
NLDBIP_19095 NLDBIP_19095 41.5 Morganella morganii S4 rusA Crossover junction endodeoxyribonuclease RusA
LHKJJB_18985 LHKJJB_18985 41.5 Morganella morganii S3 rusA Crossover junction endodeoxyribonuclease RusA

Distribution of the homologs in the orthogroup group_3377

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3377

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9MCN8 2.17e-40 133 50 0 118 3 rusA Crossover junction endodeoxyribonuclease rusA Enterobacteria phage HK97
Q37873 3.68e-38 127 48 0 120 3 rusA Crossover junction endodeoxyribonuclease rusA Enterobacteria phage 82
Q3YZH8 4.68e-38 127 48 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Shigella sonnei (strain Ss046)
Q8X707 1.63e-37 126 47 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli O157:H7
Q1RCY4 2.84e-37 125 46 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli (strain UTI89 / UPEC)
P0AG74 2.84e-37 125 46 0 120 1 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli (strain K12)
P0AG75 2.84e-37 125 46 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIR3 2.84e-37 125 46 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AA51 2.84e-37 125 46 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli O1:K1 / APEC
A7ZJG7 1.41e-35 121 45 0 120 3 rusA Crossover junction endodeoxyribonuclease RusA Escherichia coli O139:H28 (strain E24377A / ETEC)
O67766 0.000173 41 29 1 94 3 rusA Crossover junction endodeoxyribonuclease RusA Aquifex aeolicus (strain VF5)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06185
Feature type CDS
Gene -
Product RusA family crossover junction endodeoxyribonuclease
Location 1301792 - 1302163 (strand: -1)
Length 372 (nucleotides) / 123 (amino acids)
In genomic island GI68

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3377
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF05866 Endodeoxyribonuclease RusA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4570 Replication, recombination and repair (L) L Holliday junction resolvase RusA (prophage-encoded endonuclease)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01160 crossover junction endodeoxyribonuclease RusA [EC:3.1.21.10] - -

Protein Sequence

MNQYHLKLPWPPSNNTYWRHARGRHYIAEKGTKYRQHITELIKQQNLDISTTSRIKVSITANPPDKRQRDLDNLPKAVFDSLTHACFWKDDSQIDDMRIRRGERVSGGSLDITIWEIDDDSIY

Flanking regions ( +/- flanking 50bp)

GGTGTTATCAGGACGCAGGCACAACTTCTGGAGGAGGGGAAGATATCGACATGAATCAATACCACCTGAAATTGCCGTGGCCACCGTCAAATAATACGTACTGGCGTCATGCAAGGGGTCGGCACTACATCGCAGAAAAAGGAACCAAATACCGGCAGCACATCACAGAGTTAATCAAACAGCAAAACCTAGATATCAGCACCACTTCCCGCATCAAAGTCAGCATCACAGCAAATCCCCCGGACAAACGACAGAGAGACCTCGATAACCTTCCAAAGGCGGTATTCGATTCGCTCACGCATGCCTGTTTCTGGAAGGACGACAGTCAGATTGATGATATGCGCATTCGGCGCGGGGAGAGGGTGAGTGGCGGTTCTCTGGATATCACGATATGGGAGATAGATGATGACAGCATTTACTGATATTTCCTCGGCAATCGAAGAAGCCCGCTGGCTCAGGCAGGAAACAAAGC