Homologs in group_2989

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17190 FBDBKF_17190 75.7 Morganella morganii S1 - hypothetical protein
EHELCC_01700 EHELCC_01700 75.7 Morganella morganii S2 - hypothetical protein
NLDBIP_01760 NLDBIP_01760 75.7 Morganella morganii S4 - hypothetical protein
LHKJJB_00275 LHKJJB_00275 75.7 Morganella morganii S3 - hypothetical protein
HKOGLL_00315 HKOGLL_00315 75.7 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_2989

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2989

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABT1 0.000104 39 30 0 65 3 holE DNA polymerase III subunit theta Shigella flexneri
P0ABS8 0.000104 39 30 0 65 1 holE DNA polymerase III subunit theta Escherichia coli (strain K12)
P0ABS9 0.000104 39 30 0 65 3 holE DNA polymerase III subunit theta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABT0 0.000104 39 30 0 65 3 holE DNA polymerase III subunit theta Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05945
Feature type CDS
Gene -
Product hypothetical protein
Location 1265734 - 1265934 (strand: 1)
Length 201 (nucleotides) / 66 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2989
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02345 DNA polymerase III subunit theta [EC:2.7.7.7] DNA replication
Mismatch repair
Homologous recombination
-

Protein Sequence

MSENSTKPKMTREEEDEIESLAKSLVQRDKLKLLKIDKEIEQQRPERLRAWFKERLKYHRDAAKNN

Flanking regions ( +/- flanking 50bp)

GAACTATCCCGGATACAAAAATAAAGTAAACTGGCAAAAAAGGAGGATGTATGTCAGAGAATTCAACAAAGCCAAAGATGACGCGGGAAGAAGAAGATGAGATCGAATCGCTGGCTAAAAGTCTTGTACAGCGGGATAAACTGAAACTGCTTAAAATTGATAAAGAAATTGAGCAGCAGCGCCCTGAACGGTTACGGGCCTGGTTTAAAGAGCGTCTGAAATATCACCGCGACGCCGCAAAAAATAACTGATTACTGCGACGATCTCTCCGGTACAGAGTGTTCCGGAGGGATCGACTATA