Homologs in group_2998

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_01700 EHELCC_01700 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_01760 NLDBIP_01760 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_00275 LHKJJB_00275 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_00315 HKOGLL_00315 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS05945 F4V73_RS05945 75.7 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2998

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2998

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17190
Feature type CDS
Gene -
Product hypothetical protein
Location 21627 - 21740 (strand: 1)
Length 114 (nucleotides) / 37 (amino acids)
In genomic island -

Contig

Accession contig_27
Length 46634 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2998
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MSENMQKPKMTQEEEDEIESLTKSLVMRDKMKLPGTY

Flanking regions ( +/- flanking 50bp)

TCTCACACCCGGCCGTAAAATACAGTAGACTGACAGAAAAAGGAGGATCTATGTCAGAGAATATGCAGAAGCCGAAAATGACACAGGAAGAAGAGGACGAAATTGAGTCCCTGACAAAAAGCCTTGTCATGCGGGATAAGATGAAACTGCCGGGAACGTATTAAATTCCACCGCGATACGGCCAGAAACAGTTAACCGTAAAACTGAGCCTGCC