Homologs in group_1034

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05325 FBDBKF_05325 89.8 Morganella morganii S1 gsiA Glutathione import ATP-binding protein GsiA
EHELCC_12265 EHELCC_12265 89.8 Morganella morganii S2 gsiA Glutathione import ATP-binding protein GsiA
NLDBIP_12605 NLDBIP_12605 89.8 Morganella morganii S4 gsiA Glutathione import ATP-binding protein GsiA
LHKJJB_12465 LHKJJB_12465 89.8 Morganella morganii S3 gsiA Glutathione import ATP-binding protein GsiA
HKOGLL_11080 HKOGLL_11080 89.8 Morganella morganii S5 gsiA Glutathione import ATP-binding protein GsiA
PMI_RS07185 PMI_RS07185 64.4 Proteus mirabilis HI4320 - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_1034

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1034

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C0SP98 4.01e-61 198 44 5 237 3 ykfD Putative oligopeptide transport ATP-binding protein YkfD Bacillus subtilis (strain 168)
P42065 6.96e-57 187 44 2 210 3 appF Oligopeptide transport ATP-binding protein AppF Bacillus subtilis (strain 168)
P45051 3.23e-56 185 42 4 240 3 oppF Oligopeptide transport ATP-binding protein OppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P18766 3.72e-55 182 44 4 226 3 amiF Oligopeptide transport ATP-binding protein AmiF Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6D3A9 5.64e-55 189 45 5 235 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D3A9 2.55e-36 138 36 9 250 3 gsiA Glutathione import ATP-binding protein GsiA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2YJJ8 1.99e-53 178 45 3 217 3 BAB2_1053 Putative peptide import ATP-binding protein BAB2_1053 Brucella abortus (strain 2308)
Q8VQK7 1.99e-53 178 45 3 217 3 BruAb2_1034 Putative peptide import ATP-binding protein BruAb2_1034 Brucella abortus biovar 1 (strain 9-941)
P24137 2.56e-53 177 42 4 227 1 oppF Oligopeptide transport ATP-binding protein OppF Bacillus subtilis (strain 168)
A0A0H2ZH52 3.3e-53 177 47 2 196 1 dppF Di/tripeptide transport ATP-binding protein DppF Pseudomonas aeruginosa (strain UCBPP-PA14)
P0CZ33 1.82e-52 175 42 4 227 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain SSI-1)
Q5XDU4 1.82e-52 175 42 4 227 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ32 1.82e-52 175 42 4 227 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0A2V6 1.82e-52 175 42 4 227 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M1
Q8P2L5 1.94e-52 175 42 4 227 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
P72479 6.94e-52 173 39 4 233 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8YDH1 1.59e-51 174 44 2 215 3 BMEII0205 Putative peptide import ATP-binding protein BMEII0205 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q83LT3 1.88e-51 179 44 5 242 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q83LT3 8.27e-37 139 36 6 246 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri
Q0T6D3 1.88e-51 179 44 5 242 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q0T6D3 3.47e-36 138 35 6 246 3 gsiA Glutathione import ATP-binding protein GsiA Shigella flexneri serotype 5b (strain 8401)
Q32IB5 4.15e-51 179 45 5 234 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q32IB5 4.8e-38 143 36 6 246 3 gsiA Glutathione import ATP-binding protein GsiA Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z3V4 6.28e-51 178 45 5 234 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
Q3Z3V4 3.97e-38 143 37 7 240 3 gsiA Glutathione import ATP-binding protein GsiA Shigella sonnei (strain Ss046)
P75796 6.47e-51 178 45 5 234 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P75796 2.5e-38 144 37 7 240 1 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain K12)
P08007 9.15e-51 171 44 3 201 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q323W5 1.25e-50 177 45 5 234 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
Q323W5 4.3e-38 143 37 7 240 3 gsiA Glutathione import ATP-binding protein GsiA Shigella boydii serotype 4 (strain Sb227)
P77737 3.04e-50 170 44 3 201 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q0TJM0 3.51e-50 176 44 5 234 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TJM0 1.95e-38 144 36 7 246 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8X6W1 4.68e-50 176 44 5 234 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q8X6W1 5.36e-38 143 37 6 240 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O157:H7
Q1RE96 7.45e-50 175 44 5 234 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
Q1RE96 2.13e-38 144 36 7 246 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli (strain UTI89 / UPEC)
P77622 1.41e-49 167 46 3 202 2 ddpF Probable D,D-dipeptide transport ATP-binding protein DdpF Escherichia coli (strain K12)
Q8FJL0 1.94e-49 174 44 4 233 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FJL0 1.11e-37 142 36 7 246 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A967 5.1e-49 173 44 7 239 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
A1A967 2.5e-38 144 36 7 246 3 gsiA Glutathione import ATP-binding protein GsiA Escherichia coli O1:K1 / APEC
Q5PGP3 2.06e-48 171 44 5 241 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PGP3 4.59e-36 137 36 7 240 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZQM4 2.08e-48 171 44 5 241 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZQM4 4.63e-36 137 36 7 240 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z864 2.19e-48 171 44 5 241 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q8Z864 4.15e-36 137 36 7 240 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella typhi
Q57RB2 2.4e-48 171 44 5 241 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
Q57RB2 2.65e-36 138 36 7 240 3 gsiA Glutathione import ATP-binding protein GsiA Salmonella choleraesuis (strain SC-B67)
P0A2V5 5.49e-48 164 42 3 201 3 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. cremoris (strain SK11)
P0A2V4 5.49e-48 164 42 3 201 1 oppF Oligopeptide transport ATP-binding protein OppF Lactococcus lactis subsp. lactis (strain IL1403)
P45094 8.69e-48 163 42 2 201 3 dppF Dipeptide transport ATP-binding protein DppF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9CKL2 1.16e-47 168 44 4 202 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
A9CKL2 2.26e-43 157 40 6 240 3 yejF Peptidoglycan transport ATP-binding protein YejF Agrobacterium fabrum (strain C58 / ATCC 33970)
Q53194 2.88e-47 163 45 4 210 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A2RI78 4.1e-47 161 36 4 240 1 dppF Dipeptide transport ATP-binding protein DppF Lactococcus lactis subsp. cremoris (strain MG1363)
P63396 4.58e-47 167 43 2 214 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63396 2.47e-34 132 32 7 254 3 BQ2027_MB1312C Uncharacterized ABC transporter ATP-binding protein Mb1312c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQJ5 4.58e-47 167 43 2 214 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ5 2.47e-34 132 32 7 254 1 Rv1281c Uncharacterized ABC transporter ATP-binding protein Rv1281c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ4 4.58e-47 167 43 2 214 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQJ4 2.47e-34 132 32 7 254 3 MT1318 Uncharacterized ABC transporter ATP-binding protein MT1318 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P37313 3.73e-45 157 41 3 203 1 dppF Dipeptide transport ATP-binding protein DppF Escherichia coli (strain K12)
P33916 1.37e-43 157 38 6 252 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 3.65e-39 145 38 8 241 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q8FVN0 2.08e-43 150 36 4 236 2 nikE Nickel import ATP-binding protein NikE Brucella suis biovar 1 (strain 1330)
Q8YCN7 6.76e-43 149 38 5 228 3 nikE Nickel import ATP-binding protein NikE Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578S7 6.76e-43 149 38 5 228 3 nikE Nickel import ATP-binding protein NikE Brucella abortus biovar 1 (strain 9-941)
Q2YL69 6.76e-43 149 38 5 228 3 nikE Nickel import ATP-binding protein NikE Brucella abortus (strain 2308)
Q2FVF1 1.09e-41 145 36 2 217 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain NCTC 8325 / PS 47)
P0AAI0 2.33e-41 145 35 4 228 3 sapF Peptide transport system ATP-binding protein SapF Shigella flexneri
P0AAH8 2.33e-41 145 35 4 228 1 sapF Putrescine export system ATP-binding protein SapF Escherichia coli (strain K12)
P0AAH9 2.33e-41 145 35 4 228 3 sapF Peptide transport system ATP-binding protein SapF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P26905 2.79e-41 147 38 7 237 3 dppD Dipeptide transport ATP-binding protein DppD Bacillus subtilis (strain 168)
Q88ZJ6 3.98e-41 147 40 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A0A0H3JT74 1.29e-40 142 35 2 217 1 cntF Metal-staphylopine import system ATP-binding protein CntF Staphylococcus aureus (strain Mu50 / ATCC 700699)
P45052 1.5e-40 144 37 6 229 3 oppD Oligopeptide transport ATP-binding protein OppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KS33 1.91e-40 145 39 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8YDH0 2.73e-40 144 39 6 234 3 BMEII0206 Putative peptide import ATP-binding protein BMEII0206 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P24136 3.07e-40 144 36 7 232 1 oppD Oligopeptide transport ATP-binding protein OppD Bacillus subtilis (strain 168)
Q8YBN5 3.23e-40 144 39 3 225 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 3.23e-40 144 39 3 225 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 3.23e-40 144 39 3 225 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 3.23e-40 144 39 3 225 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 3.23e-40 144 39 3 225 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q02R79 3.52e-40 144 40 6 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q31VE6 3.53e-40 142 37 3 205 3 nikE Nickel import ATP-binding protein NikE Shigella boydii serotype 4 (strain Sb227)
Q9HY19 3.6e-40 144 40 6 218 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9X196 4.67e-40 144 40 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q1R5D8 5.08e-40 142 37 3 205 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain UTI89 / UPEC)
Q8FCM9 5.08e-40 142 37 3 205 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBX8 5.08e-40 142 37 3 205 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5HV18 6.2e-40 143 33 4 236 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni (strain RM1221)
Q0PAB6 6.2e-40 143 33 4 236 3 metN Methionine import ATP-binding protein MetN Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P33594 6.5e-40 141 37 3 205 3 nikE Nickel import ATP-binding protein NikE Escherichia coli (strain K12)
Q3YW48 7.39e-40 141 37 3 205 3 nikE Nickel import ATP-binding protein NikE Shigella sonnei (strain Ss046)
Q2RS22 9.99e-40 141 38 4 223 3 nikE Nickel import ATP-binding protein NikE Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q32AQ1 1.02e-39 141 37 3 205 3 nikE Nickel import ATP-binding protein NikE Shigella dysenteriae serotype 1 (strain Sd197)
P36638 1.03e-39 141 35 4 228 2 sapF Peptide transport system ATP-binding protein SapF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X4L6 1.39e-39 140 37 3 205 3 nikE Nickel import ATP-binding protein NikE Escherichia coli O157:H7
Q6D4E2 1.91e-39 143 38 6 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A5VU87 4.41e-39 141 37 8 240 3 BOV_A0348 Putative peptide import ATP-binding protein BOV_A0348 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q5PMK1 4.51e-39 142 40 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P40790 4.86e-39 142 40 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 4.86e-39 142 40 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q8Z7H7 5.01e-39 142 40 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q8FUW8 5.44e-39 140 38 6 234 3 BRA1094 Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 Brucella suis biovar 1 (strain 1330)
Q2YJJ9 5.44e-39 140 38 6 234 3 BAB2_1052 Putative peptide import ATP-binding protein BAB2_1052 Brucella abortus (strain 2308)
Q8VQK6 5.44e-39 140 38 6 234 3 BruAb2_1033 Putative peptide import ATP-binding protein BruAb2_1033 Brucella abortus biovar 1 (strain 9-941)
Q18C09 5.61e-39 140 37 5 224 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q7NQN5 7.79e-39 141 39 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8FWP1 8.07e-39 140 37 8 240 3 BRA0405 Putative peptide import ATP-binding protein BRA0405/BS1330_II0402 Brucella suis biovar 1 (strain 1330)
P50980 8.24e-39 140 34 6 233 3 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. cremoris (strain SK11)
Q8YBN6 9.77e-39 140 37 8 240 3 BMEII0863 Putative peptide import ATP-binding protein BMEII0863 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q5E586 1.13e-38 141 39 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0I3Y9 1.37e-38 140 38 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q07733 1.45e-38 140 34 6 233 1 oppD Oligopeptide transport ATP-binding protein OppD Lactococcus lactis subsp. lactis (strain IL1403)
Q2YK63 1.8e-38 139 37 7 239 3 BAB2_0817 Putative peptide import ATP-binding protein BAB2_0817 Brucella abortus (strain 2308)
Q577J5 1.8e-38 139 37 7 239 3 BruAb2_0796 Putative peptide import ATP-binding protein BruAb2_0796 Brucella abortus biovar 1 (strain 9-941)
Q6LR20 1.87e-38 140 38 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q8PP41 2.27e-38 137 41 6 203 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q0SZJ3 2.41e-38 137 36 3 204 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri serotype 5b (strain 8401)
Q3A9G5 5.31e-38 138 37 7 228 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P55662 6.12e-38 136 36 5 231 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P04285 7.22e-38 138 36 8 237 1 oppD Oligopeptide transport ATP-binding protein OppD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q73EL7 7.61e-38 138 37 6 231 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q83J77 7.65e-38 136 36 3 204 3 nikE Nickel import ATP-binding protein NikE Shigella flexneri
Q6HP89 8.92e-38 137 37 7 230 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63GR8 9.01e-38 137 37 7 230 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q81ZF5 9.91e-38 137 37 7 230 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q7MKU3 1.36e-37 138 38 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 1.36e-37 138 38 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q1B677 1.38e-37 137 37 5 222 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q48CA0 1.4e-37 135 35 7 238 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8KZQ6 1.48e-37 135 37 7 234 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q4ZLS1 1.48e-37 135 35 7 238 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q81IN8 1.5e-37 137 38 7 230 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8U648 1.5e-37 135 36 4 219 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q53193 1.68e-37 137 35 6 242 3 NGR_a01410 Probable peptide ABC transporter ATP-binding protein y4tR Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8PGE8 1.7e-37 137 40 6 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
Q3K506 1.76e-37 135 35 6 238 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
O85818 2.48e-37 137 38 5 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q6D201 2.62e-37 136 37 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A2RI77 2.93e-37 137 36 5 232 1 dppD Dipeptide transport ATP-binding protein DppD Lactococcus lactis subsp. cremoris (strain MG1363)
Q7VNG4 2.97e-37 137 38 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QK57 3.13e-37 137 37 6 228 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q3BNZ3 3.52e-37 136 40 6 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P42064 3.79e-37 135 34 5 232 3 appD Oligopeptide transport ATP-binding protein AppD Bacillus subtilis (strain 168)
Q03PF2 3.99e-37 137 38 5 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8FV85 4.09e-37 137 36 5 231 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 4.09e-37 137 36 5 231 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 4.09e-37 137 36 5 231 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 4.09e-37 137 36 5 231 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
P0AAF9 4.43e-37 133 35 6 231 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 4.43e-37 133 35 6 231 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 4.43e-37 133 35 6 231 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 4.43e-37 133 35 6 231 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q87PH3 4.56e-37 137 38 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1RD28 4.9e-37 137 38 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 4.9e-37 137 38 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
P45095 4.94e-37 135 35 6 236 3 dppD Dipeptide transport ATP-binding protein DppD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q895C4 5.18e-37 135 33 6 233 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q32EY4 5.79e-37 136 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q1IGL4 7.32e-37 134 34 7 238 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q2SJY7 8.32e-37 135 37 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q88R93 8.4e-37 133 36 7 234 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1B8V9 9.05e-37 136 36 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 9.05e-37 136 36 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
O83658 9.37e-37 136 37 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
Q0T5R2 1.06e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q4K441 1.14e-36 133 36 7 238 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3Z2Z3 1.19e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.19e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q5YRD1 1.21e-36 134 38 7 226 3 metN Methionine import ATP-binding protein MetN Nocardia farcinica (strain IFM 10152)
P45171 1.35e-36 135 37 5 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P69877 1.4e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 1.4e-36 135 38 5 219 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 1.4e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 1.4e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 1.4e-36 135 38 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
A0A0H2ZGN6 1.51e-36 134 35 7 233 1 dppD Di/tripeptide transport ATP-binding protein DppD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6D3Q6 1.77e-36 134 37 6 231 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P76027 1.77e-36 134 37 8 233 1 oppD Oligopeptide transport ATP-binding protein OppD Escherichia coli (strain K12)
P0A2U9 1.9e-36 134 36 8 236 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U8 1.9e-36 134 36 8 236 3 amiE Oligopeptide transport ATP-binding protein AmiE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q5WKL3 2.27e-36 134 37 6 225 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q2YAD6 2.52e-36 134 38 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1TAI4 2.98e-36 134 36 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q7A7E3 3.09e-36 134 34 6 226 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 3.09e-36 134 34 6 226 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6FFZ1 3.28e-36 132 37 6 229 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q13VD7 3.73e-36 134 36 6 226 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q5ZWE4 3.75e-36 134 37 6 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q9CP06 3.78e-36 134 38 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q8ZRM9 3.9e-36 133 36 5 225 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ELQ6 3.94e-36 133 34 6 223 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q97KD5 4.09e-36 133 36 5 221 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q65UE1 4.12e-36 134 39 6 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q57T09 4.15e-36 133 36 5 225 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q9HT70 4.22e-36 133 40 5 206 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK6 4.22e-36 133 40 5 206 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q87AL9 4.35e-36 133 41 5 201 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q032A0 4.73e-36 134 35 7 241 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
Q5H503 4.74e-36 133 40 7 224 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q3ILC5 4.84e-36 131 33 6 248 3 pstB Phosphate import ATP-binding protein PstB Pseudoalteromonas translucida (strain TAC 125)
Q5X627 5.03e-36 134 37 6 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q2P7S3 5.49e-36 133 40 7 224 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
D8KFN1 5.9e-36 134 35 7 241 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 5.9e-36 134 35 7 241 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q2YVT7 8.88e-36 132 35 6 226 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q0SBZ1 8.93e-36 132 35 3 214 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
P0AAG2 1.1e-35 132 34 7 243 3 dppD Dipeptide transport ATP-binding protein DppD Shigella flexneri
P0AAG0 1.1e-35 132 34 7 243 1 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli (strain K12)
P0AAG1 1.1e-35 132 34 7 243 3 dppD Dipeptide transport ATP-binding protein DppD Escherichia coli O157:H7
Q0S0Z3 1.11e-35 132 34 3 214 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q9A502 1.15e-35 132 38 6 221 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8Z990 1.18e-35 132 36 6 226 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q8XBJ8 1.36e-35 132 38 6 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
P16676 1.49e-35 132 38 6 227 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8FFB3 1.54e-35 132 38 6 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8EBC3 1.6e-35 132 41 7 223 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8P4S7 1.68e-35 132 40 6 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 1.68e-35 132 40 6 215 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q46Y69 1.74e-35 132 37 6 227 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7N6Z2 1.97e-35 132 38 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8DUF7 2e-35 132 39 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q87UI3 2.54e-35 129 34 7 238 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P54537 2.76e-35 129 35 5 221 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q3M5J9 2.88e-35 129 33 4 218 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YA75 2.9e-35 131 38 6 228 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5PID0 2.94e-35 131 35 5 225 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q32JQ8 3.45e-35 131 36 6 225 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q9G4F5 3.52e-35 131 38 4 220 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
O34677 3.55e-35 128 34 5 221 2 glnQ Glutamine transport ATP-binding protein GlnQ Bacillus subtilis (strain 168)
Q9CIN4 4.27e-35 131 34 7 241 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q98HF7 4.32e-35 131 38 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q325U1 4.53e-35 130 36 6 225 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q82TL6 4.88e-35 131 36 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8RFN2 4.92e-35 130 38 5 206 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5WXF0 4.95e-35 131 37 6 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q3Z5F8 4.98e-35 130 36 6 225 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 4.98e-35 130 36 6 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 4.98e-35 130 36 6 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLD2 4.98e-35 130 36 6 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P63356 4.98e-35 130 36 6 225 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q8DIA0 5.18e-35 130 37 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q4KKK8 5.35e-35 130 40 5 199 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6GJL2 5.37e-35 130 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q8NY21 5.43e-35 130 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 5.43e-35 130 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q5WVL8 5.66e-35 130 36 4 219 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q7UC29 6.08e-35 131 38 6 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q5HIL5 7.06e-35 130 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 7.06e-35 130 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 7.06e-35 130 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q65M34 7.43e-35 130 36 4 198 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5ZUG5 7.68e-35 130 36 4 219 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P30750 8.88e-35 130 35 6 225 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q8Z0H0 9.82e-35 130 37 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8DZJ0 1.16e-34 130 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.16e-34 130 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.16e-34 130 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9KUI0 1.16e-34 130 39 6 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1TXH7 1.18e-34 130 37 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q724C0 1.29e-34 129 37 6 228 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q83F44 1.47e-34 129 35 6 236 3 metN Methionine import ATP-binding protein MetN Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q88RL5 1.47e-34 129 40 4 196 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P14788 1.55e-34 129 36 5 225 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q3MAR5 1.6e-34 130 36 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q83MC5 1.63e-34 129 36 6 225 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 1.63e-34 129 36 6 225 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q8G5P8 1.76e-34 130 36 7 234 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
Q881U6 1.88e-34 126 38 7 213 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q46BM0 1.96e-34 127 33 7 253 3 pstB Phosphate import ATP-binding protein PstB Methanosarcina barkeri (strain Fusaro / DSM 804)
Q1BY14 1.99e-34 129 37 6 227 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 1.99e-34 129 37 6 227 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q0RYP7 2.05e-34 129 34 3 214 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
P40860 2.16e-34 129 37 6 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q12L15 2.21e-34 127 33 6 248 3 pstB Phosphate import ATP-binding protein PstB Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q92EZ6 2.43e-34 129 37 6 228 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q110U3 2.51e-34 129 39 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q8YM92 2.53e-34 129 36 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q0AGF4 2.57e-34 129 37 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8RI39 2.6e-34 129 37 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5FM17 2.61e-34 126 35 6 227 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8ELA5 2.61e-34 129 35 6 227 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8DPC2 2.71e-34 129 37 7 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 2.71e-34 129 37 7 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 2.71e-34 129 37 7 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8CQS7 2.77e-34 129 33 6 226 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 2.77e-34 129 33 6 226 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8E3S0 2.96e-34 129 37 7 234 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype III (strain NEM316)
Q5PCG9 2.99e-34 128 36 6 225 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5X484 3.08e-34 128 36 4 219 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q9I6L0 3.09e-34 128 37 5 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A3CMQ7 3.17e-34 129 37 7 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q8Z4V6 3.29e-34 129 37 6 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q3KK97 3.3e-34 128 38 5 204 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q89UD2 3.4e-34 128 39 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q12XW6 3.49e-34 126 33 7 255 3 pstB Phosphate import ATP-binding protein PstB Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8DY54 3.61e-34 129 37 7 234 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZP8 3.61e-34 129 37 7 234 3 metN Methionine import ATP-binding protein MetN Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8ZR89 3.62e-34 128 36 6 225 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q1CFH7 4.12e-34 128 35 7 227 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 4.12e-34 128 35 7 227 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 4.12e-34 128 35 7 227 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
P27675 4.13e-34 125 37 7 216 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q0BH79 4.2e-34 128 37 6 227 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q667L9 4.57e-34 128 35 7 227 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7VV72 4.67e-34 128 38 6 226 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 4.67e-34 128 38 6 226 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 4.67e-34 128 38 6 226 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q47T99 5.25e-34 129 38 7 226 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q832Y6 5.27e-34 128 36 6 234 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q7M816 5.49e-34 127 41 6 198 3 metN Methionine import ATP-binding protein MetN Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q830W6 5.6e-34 128 36 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
P0CZ35 5.65e-34 129 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 5.65e-34 129 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 5.65e-34 129 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q6D1C4 5.76e-34 128 36 6 225 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5XCA4 6.53e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q7CN92 6.81e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 6.81e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q9K876 7.27e-34 128 36 5 221 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9PF03 7.28e-34 127 41 6 201 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q88CL2 7.4e-34 127 36 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9MUN1 7.42e-34 127 37 6 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q03Z27 7.95e-34 128 35 5 234 3 metN Methionine import ATP-binding protein MetN Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1J6Q6 8.05e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 8.05e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 8.05e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 8.05e-34 128 37 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q4L5B3 8.09e-34 128 34 5 218 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q160M2 8.82e-34 127 37 6 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q63TY1 9e-34 127 38 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q4ZZR8 1.04e-33 127 38 5 202 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q1LQF6 1.06e-33 127 36 6 225 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q62K82 1.06e-33 127 38 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
P31134 1.11e-33 128 37 9 229 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q9CGD4 1.15e-33 129 38 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q0BMC9 1.27e-33 127 35 5 222 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 1.27e-33 127 35 5 222 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
P77795 1.28e-33 127 37 6 219 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
Q57S53 1.29e-33 127 36 6 225 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q668K6 1.31e-33 127 39 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
P75186 1.35e-33 126 34 7 235 3 pstB Phosphate import ATP-binding protein PstB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q0HTE5 1.42e-33 125 32 7 257 3 pstB Phosphate import ATP-binding protein PstB Shewanella sp. (strain MR-7)
Q0HH38 1.42e-33 125 32 7 257 3 pstB Phosphate import ATP-binding protein PstB Shewanella sp. (strain MR-4)
Q02Z10 1.46e-33 128 38 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q02QT1 1.5e-33 125 35 5 214 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q88AS5 1.55e-33 126 36 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87UN4 1.57e-33 126 38 5 204 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7NIW1 1.59e-33 127 37 4 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9HYG4 1.62e-33 125 35 5 214 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q084V3 1.66e-33 125 32 7 257 3 pstB Phosphate import ATP-binding protein PstB Shewanella frigidimarina (strain NCIMB 400)
Q88HL0 1.68e-33 125 38 3 211 3 nikE Nickel import ATP-binding protein NikE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q38WL5 1.82e-33 126 38 5 207 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q82WT5 2e-33 127 38 5 225 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8EG82 2.14e-33 124 33 6 248 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6MU19 2.31e-33 126 36 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q043Y8 2.37e-33 126 34 4 226 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q1IGZ0 2.46e-33 126 40 4 196 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q48PU6 2.85e-33 125 37 5 204 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8D653 2.86e-33 126 38 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q7MNI7 3.31e-33 124 32 7 257 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain YJ016)
Q8DEW5 3.31e-33 124 32 7 257 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio vulnificus (strain CMCP6)
P47650 3.47e-33 125 34 7 231 3 pstB Phosphate import ATP-binding protein PstB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8Z8R5 3.57e-33 125 36 6 225 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q47Y12 3.57e-33 124 33 6 248 3 pstB Phosphate import ATP-binding protein PstB Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q9CIS9 3.92e-33 124 36 7 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q0SFW6 3.95e-33 125 36 7 228 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q5NFU5 4.16e-33 125 35 5 222 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q6D5H7 4.3e-33 125 36 6 229 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0AU85 4.3e-33 125 35 6 228 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q74IV9 4.39e-33 125 34 5 229 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q2SSS4 4.42e-33 125 35 6 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q14H97 4.48e-33 125 35 5 222 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q5M397 4.82e-33 126 38 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q52666 4.87e-33 123 36 5 220 3 bztD Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
D4GP38 5.04e-33 126 34 5 217 1 xacJ Xylose/arabinose import ATP-binding protein XacJ Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q1QE80 5.17e-33 126 36 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q12B04 5.22e-33 125 38 5 201 3 metN Methionine import ATP-binding protein MetN Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5LYN4 5.34e-33 126 38 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q7VZE5 5.35e-33 125 37 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2NRN5 5.43e-33 125 38 5 201 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q03JH1 5.51e-33 126 38 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
P74548 5.74e-33 125 37 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6MCV4 5.82e-33 125 37 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q1AS06 6.3e-33 125 37 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q2SY12 6.35e-33 125 37 7 228 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q7WGW1 6.39e-33 125 37 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8D0W8 6.48e-33 125 38 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q93DA2 6.59e-33 125 35 6 233 3 metN Methionine import ATP-binding protein MetN Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q6NBT1 6.69e-33 125 38 5 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7W9U5 6.73e-33 125 37 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q63S19 6.83e-33 125 37 7 228 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 6.83e-33 125 37 7 228 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 6.83e-33 125 37 7 228 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q5E715 6.9e-33 125 34 7 232 3 metN Methionine import ATP-binding protein MetN Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q38VW6 6.98e-33 125 36 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q14Q07 7.02e-33 125 36 7 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q665B6 7.17e-33 123 33 6 227 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q03AH0 7.53e-33 125 37 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q032H4 7.72e-33 123 36 7 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 7.72e-33 123 36 7 224 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q81IZ6 8.04e-33 125 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1WVI7 8.53e-33 125 36 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
P72297 9.19e-33 122 33 6 236 3 occP Octopine permease ATP-binding protein P Rhizobium meliloti
Q3IS07 9.3e-33 123 35 8 236 3 pstB1 Phosphate import ATP-binding protein PstB 1 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q8DMX9 1.02e-32 123 36 6 220 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 1.02e-32 123 36 6 220 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 1.02e-32 123 36 6 220 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q39IE7 1.14e-32 124 36 6 227 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7MN25 1.19e-32 124 34 6 225 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q8DFC3 1.33e-32 124 34 6 225 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
P45092 1.41e-32 122 33 7 225 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P10346 1.54e-32 121 33 4 228 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q73F11 1.69e-32 124 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q47RE8 1.69e-32 123 40 6 221 3 metN Methionine import ATP-binding protein MetN Thermobifida fusca (strain YX)
Q21BU8 1.71e-32 124 35 7 238 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q2NHA1 1.73e-32 122 33 4 219 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q2RM86 1.89e-32 122 34 7 249 3 pstB Phosphate import ATP-binding protein PstB Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q134N9 2.05e-32 124 39 7 225 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q0KDG3 2.05e-32 124 36 6 225 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q53I83 2.48e-32 124 39 5 204 3 metN Methionine import ATP-binding protein MetN Streptomyces griseus
Q07LR5 2.52e-32 124 39 6 216 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisA53)
A0PY57 2.67e-32 123 35 6 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q8DWR3 2.76e-32 122 34 7 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 2.76e-32 122 34 7 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 2.76e-32 122 34 7 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q9PHQ1 2.9e-32 121 34 6 224 3 pstB Phosphate import ATP-binding protein PstB Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q3KBH4 3.43e-32 123 35 6 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
P45022 3.54e-32 121 34 6 229 3 HI_1078 Probable amino-acid ABC transporter ATP-binding protein HI_1078 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65T42 3.65e-32 123 36 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q03P57 3.81e-32 123 34 7 243 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1CDR0 3.91e-32 121 33 6 227 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 3.91e-32 121 33 6 227 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 3.91e-32 121 33 6 227 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q5HVF4 4.25e-32 120 34 6 224 3 pstB Phosphate import ATP-binding protein PstB Campylobacter jejuni (strain RM1221)
P37774 4.3e-32 120 36 7 232 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q8F6Z1 4.67e-32 123 36 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 4.67e-32 123 36 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6F0V4 5.06e-32 123 35 7 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8PVF6 5.08e-32 120 34 7 246 3 pstB Phosphate import ATP-binding protein PstB Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q52815 5.24e-32 120 34 5 226 3 aapP General L-amino acid transport ATP-binding protein AapP Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q48IB9 6.27e-32 120 35 5 215 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q65M64 6.31e-32 120 34 7 213 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q6LU82 6.37e-32 120 35 7 236 3 pstB1 Phosphate import ATP-binding protein PstB 1 Photobacterium profundum (strain SS9)
Q98FL5 6.39e-32 120 33 7 247 3 pstB Phosphate import ATP-binding protein PstB Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q0BFQ0 6.59e-32 122 34 5 222 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q4ZTG9 6.61e-32 120 37 6 215 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q8RQL7 6.79e-32 120 34 5 223 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P39456 6.81e-32 120 33 6 225 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
P38045 7.16e-32 126 38 6 207 1 nrtC Nitrate import ATP-binding protein NrtC Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q64SQ6 7.36e-32 124 35 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q6LN52 7.57e-32 122 36 8 229 3 metN Methionine import ATP-binding protein MetN Photobacterium profundum (strain SS9)
Q722B1 7.74e-32 122 36 7 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q92DL6 7.82e-32 122 36 7 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q50801 8.1e-32 120 34 4 220 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q5LBT4 8.57e-32 124 35 5 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q92LX3 8.66e-32 122 40 5 196 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q21XJ9 9.29e-32 120 34 6 218 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q3AAA4 9.3e-32 120 32 9 260 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7NWX3 9.73e-32 122 37 5 215 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1J8E4 9.95e-32 122 35 8 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q93DX8 1.01e-31 120 36 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q81VM2 1.04e-31 122 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q9KTJ5 1.13e-31 122 35 7 228 3 metN Methionine import ATP-binding protein MetN Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O31339 1.18e-31 122 35 5 223 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q87S48 1.19e-31 120 33 8 249 3 pstB1 Phosphate import ATP-binding protein PstB 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1JII9 1.21e-31 122 35 7 231 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q63H29 1.22e-31 122 34 5 223 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q87RS1 1.25e-31 122 33 6 225 1 metN Methionine import ATP-binding protein MetN Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9JZW0 1.28e-31 122 34 4 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q0SML1 1.42e-31 121 31 6 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q1JNE0 1.48e-31 122 35 7 231 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 1.48e-31 122 35 7 231 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q5FKL2 1.48e-31 122 32 6 230 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8Y8T6 1.55e-31 122 36 7 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5XDS8 1.66e-31 121 35 7 231 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9JUX4 1.66e-31 121 34 4 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8U7G2 1.69e-31 122 36 8 238 3 metN Methionine import ATP-binding protein MetN Agrobacterium fabrum (strain C58 / ATCC 33970)
A0AGP9 1.69e-31 122 36 7 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P0CZ31 1.71e-31 121 35 8 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 1.71e-31 121 35 8 238 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q4JTG9 1.78e-31 122 39 4 196 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q8R7Y5 1.8e-31 120 33 3 196 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q2KVK2 1.81e-31 121 36 6 226 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q03A07 1.83e-31 121 38 6 200 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q2FVF0 1.85e-31 119 29 5 240 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q48V78 2.11e-31 121 35 7 231 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 2.11e-31 121 35 7 231 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
P56344 2.12e-31 118 34 6 218 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q8NQU4 2.35e-31 119 34 7 229 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q609Q1 2.39e-31 121 35 4 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8P2K6 2.39e-31 121 33 4 235 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q1WVG9 2.45e-31 121 34 5 230 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
P0A2V2 2.54e-31 119 34 8 241 2 occP Octopine permease ATP-binding protein P Rhizobium radiobacter
P0A2V3 2.54e-31 119 34 8 241 3 occP Octopine permease ATP-binding protein P Agrobacterium tumefaciens (strain Ach5)
O27764 2.55e-31 119 34 7 229 3 pstB Phosphate import ATP-binding protein PstB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q7NX01 2.56e-31 121 36 5 225 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5L222 2.63e-31 121 34 6 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q5WET7 2.74e-31 119 31 7 261 3 pstB2 Phosphate import ATP-binding protein PstB 2 Shouchella clausii (strain KSM-K16)
P44513 2.8e-31 121 32 3 238 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q39GW5 2.86e-31 120 35 5 214 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5NN23 3.12e-31 118 34 6 219 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q13LD8 3.18e-31 121 39 6 196 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q74KF8 3.49e-31 118 34 6 227 3 pstB2 Phosphate import ATP-binding protein PstB 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5JEP9 3.66e-31 118 35 5 227 3 pstB Phosphate import ATP-binding protein PstB Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9CNJ7 3.78e-31 118 33 7 247 3 pstB Phosphate import ATP-binding protein PstB Pasteurella multocida (strain Pm70)
P0A9S0 3.79e-31 117 36 6 209 3 ftsE Cell division ATP-binding protein FtsE Shigella flexneri
P0A9R7 3.79e-31 117 36 6 209 1 ftsE Cell division ATP-binding protein FtsE Escherichia coli (strain K12)
P0A9R8 3.79e-31 117 36 6 209 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9R9 3.79e-31 117 36 6 209 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O157:H7
Q5E3B8 3.81e-31 119 34 8 228 3 pstB2 Phosphate import ATP-binding protein PstB 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9YGA6 4.1e-31 121 35 6 208 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q8NSN2 4.32e-31 120 38 5 196 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q57SD6 4.34e-31 120 36 8 230 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
A0A0H3JXA3 4.46e-31 118 29 5 240 1 cntD Metal-staphylopine import system ATP-binding protein CntD Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1QVQ7 4.52e-31 120 39 5 200 3 metN Methionine import ATP-binding protein MetN Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05780
Feature type CDS
Gene -
Product ABC transporter ATP-binding protein
Location 1228948 - 1229688 (strand: 1)
Length 741 (nucleotides) / 246 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1034
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1124 Amino acid transport and metabolism (E)
Inorganic ion transport and metabolism (P)
EP ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component

Protein Sequence

MPENNPAPIIEVNNLSVSFGQRQVVCKAGFHLNAGETFSLIGESGCGKSTILRVIAGLQREWQGGVQLLSQHIHPGLRYQGALRRNVQMVFQDPYASLHPFHTIHRALAEPLHIHNENDIEARVTQAIESVGLPPDVAQRYPHQLSGGQRQRIAIARALMLRPQILLLDEPTSALDMSVQAEILNLLNHLKTEHSMTYLMVSHDADVVAHMSDRAAFMAHGEIVREFDRAALVRGEHRMETTEEVR

Flanking regions ( +/- flanking 50bp)

GGTACTGGACAGACAGGCGTTGCAGACTTTACTGACTCAGGAGACTCATCATGCCGGAAAATAATCCAGCGCCGATTATTGAGGTTAATAATCTTTCCGTCAGTTTCGGGCAGCGGCAGGTCGTCTGCAAGGCTGGCTTTCACCTCAATGCAGGCGAGACATTCAGTCTTATTGGTGAGTCCGGATGCGGAAAATCCACTATCCTGCGGGTGATCGCCGGATTACAGCGGGAATGGCAGGGAGGCGTTCAGCTGCTGTCACAGCATATACATCCGGGGCTGCGCTATCAGGGCGCACTGCGCCGCAATGTACAGATGGTATTTCAGGATCCTTACGCGTCCCTGCATCCGTTTCATACTATTCACCGCGCCCTTGCCGAGCCGTTACACATTCATAATGAGAATGATATTGAAGCCAGGGTCACACAGGCAATAGAATCTGTCGGATTACCGCCGGATGTAGCGCAGCGCTATCCTCACCAGCTCTCCGGCGGACAGCGCCAACGTATTGCGATTGCCCGCGCACTGATGCTGCGCCCGCAGATTTTATTGCTGGATGAACCGACTTCCGCACTGGATATGTCCGTTCAGGCCGAAATTCTCAATCTGCTGAATCACCTGAAAACTGAACACAGTATGACCTATCTGATGGTCAGTCATGACGCCGATGTGGTCGCGCATATGTCTGACAGAGCGGCATTTATGGCGCACGGAGAGATTGTACGGGAGTTTGATCGCGCGGCATTAGTCCGGGGAGAGCACCGGATGGAAACAACAGAAGAAGTTCGCTGAGCAGTTAAACAAAAGCAAAAACGGGGCTAATGCCCCGTTCAGATTGCGGA