Homologs in group_2708

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05205 FBDBKF_05205 86.5 Morganella morganii S1 qseB quorum sensing response regulator transcription factor QseB
EHELCC_12385 EHELCC_12385 86.5 Morganella morganii S2 qseB quorum sensing response regulator transcription factor QseB
NLDBIP_12725 NLDBIP_12725 86.5 Morganella morganii S4 qseB quorum sensing response regulator transcription factor QseB
LHKJJB_12585 LHKJJB_12585 86.5 Morganella morganii S3 qseB quorum sensing response regulator transcription factor QseB
HKOGLL_11200 HKOGLL_11200 86.5 Morganella morganii S5 qseB quorum sensing response regulator transcription factor QseB

Distribution of the homologs in the orthogroup group_2708

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2708

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P66795 3.23e-107 310 67 0 218 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 3.23e-107 310 67 0 218 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q8XBS3 4.69e-107 310 68 0 218 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P52076 1.09e-106 309 67 0 218 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P45337 1.86e-99 291 63 0 218 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HV32 3.58e-70 216 51 0 214 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0I1 2.92e-59 189 46 1 215 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0R3I8 1.16e-54 177 41 2 223 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1TEL7 9.74e-54 175 41 2 224 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0PWB4 1.42e-53 174 40 2 225 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q1B3X8 9.03e-53 172 41 2 223 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 9.03e-53 172 41 2 223 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 9.03e-53 172 41 2 223 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q742C1 9.48e-53 172 40 2 223 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 9.48e-53 172 40 2 223 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A1KHB7 2.6e-51 169 39 2 223 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 2.6e-51 169 39 2 223 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P30843 3.31e-51 168 41 0 222 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q9CD68 4.81e-51 168 39 2 223 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q70FH0 5.76e-51 167 42 0 216 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
P9WGM9 6.06e-51 167 39 2 223 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 6.06e-51 167 39 2 223 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 6.06e-51 167 39 2 223 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P36556 3.41e-50 166 40 0 222 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ACZ8 7.23e-48 160 37 2 221 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 7.23e-48 160 37 2 221 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 7.23e-48 160 37 2 221 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q8GP20 6.3e-46 154 39 0 216 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q9ZHD3 2.16e-45 153 39 4 224 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P0DMK7 1.12e-44 152 39 2 220 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 1.12e-44 152 39 2 220 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q47456 1.73e-44 151 38 1 219 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q02540 2.9e-44 150 36 2 226 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P0CL17 4.62e-44 150 38 3 223 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 4.62e-44 150 38 3 223 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q7D9K0 2.78e-42 146 40 1 223 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.78e-42 146 40 1 223 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
L7N689 3.79e-41 143 36 3 222 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P76340 1.04e-40 141 36 3 218 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q44006 6.82e-40 139 35 2 220 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q01473 2.41e-39 146 38 1 221 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 4.87e-06 50 26 1 119 3 rcaC Protein RcaC Microchaete diplosiphon
P55701 2.42e-39 138 36 2 220 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q50136 2.77e-39 138 37 2 209 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q55933 1.25e-38 136 37 5 231 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WGM1 1.33e-38 136 37 2 208 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 1.33e-38 136 37 2 208 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 1.33e-38 136 37 2 208 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0A4H8 1.63e-38 135 36 6 227 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 1.63e-38 135 36 6 227 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0C001 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 2.33e-38 135 35 4 220 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 2.33e-38 135 35 4 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
P32040 8.98e-38 134 37 4 232 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q4L6C6 1.1e-37 133 35 4 218 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P42244 2.44e-37 132 38 4 226 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q99U73 3.03e-37 132 34 3 219 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q9I4F9 1.67e-36 130 34 3 225 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q49XM7 1.91e-36 130 35 4 219 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q47744 2.39e-36 130 34 2 216 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P94413 4.47e-36 129 33 4 228 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
O69730 5.25e-36 129 37 3 220 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P39663 6.73e-36 130 36 4 233 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O34903 1.64e-35 128 33 2 219 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q82EB1 2.52e-35 128 34 3 228 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9ZEP4 4.2e-35 127 34 3 227 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0A4I2 4.52e-35 127 35 1 215 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 4.52e-35 127 35 1 215 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WGL9 5.05e-35 127 36 4 224 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 5.05e-35 127 36 4 224 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 5.05e-35 127 36 4 224 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8CP82 2.03e-34 125 36 3 218 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPC3 2.23e-34 125 36 3 218 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9F868 5.97e-34 124 35 3 224 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B8H358 1.05e-33 123 34 3 229 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.05e-33 123 34 3 229 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0A4I0 3.18e-32 119 31 2 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 3.18e-32 119 31 2 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
A6WZ81 5.08e-32 119 34 3 226 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FZ93 1.22e-31 118 34 3 226 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.22e-31 118 34 3 226 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.22e-31 118 34 3 226 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.22e-31 118 34 3 226 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.22e-31 118 34 3 226 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.22e-31 118 34 3 226 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.22e-31 118 34 3 226 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.22e-31 118 34 3 226 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q55890 3.48e-31 117 33 3 227 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DPL7 4.1e-31 117 32 4 232 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 4.1e-31 117 32 4 232 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 4.1e-31 117 32 4 232 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8CQK0 6.32e-31 116 29 3 231 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 6.32e-31 116 29 3 231 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8Z7H2 7.94e-31 116 32 1 220 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P23836 8.17e-31 115 32 1 220 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q52990 9.51e-31 115 32 3 222 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q83RR0 9.59e-31 115 32 1 220 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 9.59e-31 115 32 1 220 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P13792 1.27e-30 115 31 2 230 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q4LAJ9 1.44e-30 115 29 3 231 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P0DM78 1.73e-30 115 32 1 220 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 1.73e-30 115 32 1 220 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 1.73e-30 115 32 1 220 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 1.73e-30 115 32 1 220 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 1.73e-30 115 32 1 220 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC3 1.85e-30 115 32 1 220 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q4A160 2.81e-30 115 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A216 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2.9e-30 114 29 3 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2.9e-30 114 29 3 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2.9e-30 114 29 3 227 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2.9e-30 114 29 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8X738 3.88e-30 114 32 1 220 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P9WGM7 2.29e-29 112 35 2 221 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 2.29e-29 112 35 2 221 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 2.29e-29 112 35 2 221 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 2.44e-29 112 35 2 221 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QTK2 5.41e-29 111 35 2 221 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CCJ2 1.01e-28 110 34 2 221 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P54884 1.02e-28 109 35 4 197 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q31S42 1.21e-28 111 33 4 230 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P35163 2.38e-28 110 31 4 227 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q5HLN2 2.7e-28 109 30 2 218 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P23620 4.75e-28 108 29 4 221 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KM23 5.09e-28 109 33 3 213 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45605 5.63e-28 108 33 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P45606 8.25e-28 108 32 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q7A1J1 1.01e-27 108 30 4 222 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.01e-27 108 30 4 222 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.01e-27 108 30 4 222 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.01e-27 108 30 4 222 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.01e-27 108 30 4 222 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.01e-27 108 30 4 222 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.01e-27 108 30 4 222 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.01e-27 108 30 4 222 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.01e-27 108 30 4 222 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.01e-27 108 30 4 222 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P0AFJ5 1.01e-27 108 32 4 224 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.01e-27 108 32 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P08368 1.61e-27 107 32 2 221 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P37478 1.77e-27 107 29 4 233 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q2FWH6 2.5e-27 107 32 6 226 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8CN92 5.18e-27 106 30 2 218 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P45607 9.07e-27 105 31 3 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P69228 1.51e-26 105 32 3 220 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 1.51e-26 105 32 3 220 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P54443 1.81e-26 105 33 6 230 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P48259 2.36e-26 104 30 5 231 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q7A0U4 2.62e-26 104 29 4 235 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 2.62e-26 104 29 4 235 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 2.62e-26 104 29 4 235 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 2.62e-26 104 29 4 235 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 2.62e-26 104 29 4 235 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 2.62e-26 104 29 4 235 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 2.62e-26 104 29 4 235 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 2.62e-26 104 29 4 235 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
A0A4P7TS68 2.79e-26 104 29 2 230 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 2.79e-26 104 29 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 2.79e-26 104 29 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 2.79e-26 104 29 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 2.79e-26 104 29 2 230 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 2.79e-26 104 29 2 230 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 2.79e-26 104 29 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 2.79e-26 104 29 2 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q07783 4.89e-26 103 28 3 233 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P21866 6.61e-26 103 33 7 226 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P28835 1.87e-25 102 30 5 236 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q9AE24 1.88e-25 102 29 2 222 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P31079 2.12e-25 102 32 6 230 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P50351 2.12e-25 102 29 3 233 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2YZ24 3.16e-25 101 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GE73 3.66e-25 101 30 3 198 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
G3XCY6 6.42e-25 101 33 5 229 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04942 7.14e-25 100 33 2 219 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P51358 8.26e-25 100 31 7 232 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 9.18e-25 100 31 7 232 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q7A039 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 1e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
O78428 1.06e-24 100 29 4 229 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
A6QJK3 1.07e-24 100 31 2 177 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.07e-24 100 31 2 177 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P50350 1.12e-24 100 28 3 232 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q04803 1.97e-24 101 32 4 224 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8CQ17 2.02e-24 99 28 4 223 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 2.02e-24 99 28 4 223 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49ZT8 2.35e-24 99 31 2 173 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P28257 4.45e-24 99 30 4 229 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q06239 5.16e-24 98 28 5 227 3 vanR Regulatory protein VanR Enterococcus faecium
P45189 5.67e-24 98 28 3 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8CQ37 5.83e-24 98 30 5 224 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 5.83e-24 98 30 5 224 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O06978 7.08e-24 98 30 5 225 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q9TLQ4 7.98e-24 98 29 6 231 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q4L8L9 9.37e-24 97 33 2 173 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P94504 1.12e-23 97 29 5 224 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P9WGN1 1.17e-23 97 31 4 222 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 1.17e-23 97 31 4 222 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A0H3GGB5 2.9e-23 96 33 5 228 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
O34951 2.96e-23 96 29 3 228 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
O32192 5.68e-23 95 31 4 223 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q9K621 4.83e-22 93 26 3 226 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P58357 5.2e-22 93 28 4 225 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P0AE90 7.58e-22 92 33 5 228 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 7.58e-22 92 33 5 228 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 7.58e-22 92 33 5 228 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P42421 8.34e-22 92 31 4 225 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q6GJ11 1.8e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
A8Z181 2.1e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 2.1e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 2.1e-21 91 29 5 224 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 2.1e-21 91 29 5 224 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 2.1e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q49VK3 2.34e-21 91 31 8 227 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A1L2 2.68e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 2.68e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 2.68e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 2.68e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 2.68e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 2.68e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YSS2 2.88e-21 91 29 5 224 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q932F1 4.86e-21 90 29 5 224 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P38684 8.78e-21 90 28 4 226 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
O31432 2.26e-20 88 30 7 222 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
Q8DN02 3.96e-20 87 28 3 215 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 3.96e-20 87 28 3 215 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P44895 4.93e-20 87 32 8 233 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4L481 9.65e-20 87 30 8 232 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q9HUI2 1.33e-19 87 30 6 233 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A9Q4 2.94e-18 83 28 4 235 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.94e-18 83 28 4 235 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.94e-18 83 28 4 235 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.94e-18 83 28 4 235 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q07597 8.06e-18 82 26 6 228 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
P40138 1.13e-17 83 32 3 165 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q44929 2.57e-17 80 27 4 233 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P13359 3.52e-17 80 29 6 230 3 virG Regulatory protein VirG Rhizobium rhizogenes
O24973 7.99e-17 79 30 4 223 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
O25918 1.25e-16 78 25 4 215 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P62722 1.43e-16 79 31 5 229 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
P33112 1.74e-15 75 29 3 187 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P44918 1.96e-15 75 26 4 234 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44444 3.94e-15 75 31 5 229 3 virG Regulatory protein VirG Rhizobium radiobacter
P07545 7.89e-14 71 30 5 229 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P48359 3.58e-13 69 25 6 211 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P0AFB8 6.16e-13 70 35 0 120 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 6.16e-13 70 35 0 120 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P23221 7.22e-13 68 32 0 116 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q06065 1.21e-12 69 28 4 185 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P41789 1.78e-12 69 33 1 133 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9KQD5 6.27e-12 63 33 2 121 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 6.27e-12 63 33 2 121 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P03029 7.21e-12 67 37 0 106 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q51455 1.03e-11 63 31 2 124 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8FUS8 1.1e-11 65 26 7 229 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 1.1e-11 65 26 7 229 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 1.1e-11 65 26 7 229 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 1.1e-11 65 26 7 229 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q9I4N3 1.23e-11 66 32 1 137 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A5VW00 6.32e-11 63 26 7 229 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q93P00 1.05e-10 60 30 2 121 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
Q9ZWS7 1.38e-10 62 33 2 102 1 ARR7 Two-component response regulator ARR7 Arabidopsis thaliana
P38889 3.46e-10 62 25 0 158 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P28787 4.75e-10 62 34 0 114 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q8D0P1 4.76e-10 58 29 2 121 3 cheY Chemotaxis protein CheY Yersinia pestis
P44845 4.86e-10 60 31 9 210 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52108 9.54e-10 60 26 6 232 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q54SP4 1.01e-09 61 27 3 136 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P13632 1.02e-09 61 33 2 105 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P0AE69 2.03e-09 57 29 2 121 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 2.03e-09 57 29 2 121 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 2.03e-09 57 29 2 121 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P0A2D5 2.37e-09 57 28 2 121 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 2.37e-09 57 28 2 121 3 cheY Chemotaxis protein CheY Salmonella typhi
Q1XDE4 3.36e-09 58 27 2 120 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q8FGP6 3.59e-09 56 29 2 121 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39486 4.57e-09 58 34 3 123 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P23747 5.95e-09 58 33 1 126 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O05251 6.84e-09 57 27 3 137 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q88RJ6 7.38e-09 58 33 1 126 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9FAD7 7.62e-09 55 32 2 102 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q9K998 9.26e-09 57 34 3 116 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q88AQ2 2.12e-08 57 32 1 126 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9F8D7 3.35e-08 57 28 3 128 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
B8GZM2 3.41e-08 56 30 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 3.41e-08 56 30 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O14283 4.95e-08 56 31 0 102 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2KCH7 5.44e-08 53 32 6 123 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P72781 5.89e-08 55 25 7 216 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZCY9 7.75e-08 55 28 4 155 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q9WY30 8.86e-08 55 26 2 120 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P10577 1.07e-07 55 28 1 124 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P10046 1.08e-07 55 32 4 121 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q9APD9 1.21e-07 55 28 2 138 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q5A4X5 1.25e-07 55 28 0 112 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q5A599 1.38e-07 55 30 4 113 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P14375 1.64e-07 54 29 0 119 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q87GU5 1.87e-07 54 30 1 103 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q05943 2.06e-07 53 31 3 127 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8X613 2.1e-07 54 29 0 118 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P58402 2.28e-07 54 29 0 97 3 evgS Sensor protein EvgS Escherichia coli O157:H7
Q4UL27 3.47e-07 53 32 1 103 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P30855 3.63e-07 53 28 1 110 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
Q87MX7 3.78e-07 53 26 0 114 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0C5S5 4.34e-07 53 26 0 114 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 4.34e-07 53 26 0 114 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P96602 4.92e-07 52 33 2 106 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q7CQM5 5.07e-07 52 29 2 122 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q92HC2 5.37e-07 53 31 1 103 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9HU19 5.42e-07 53 31 0 102 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P51343 5.48e-07 52 29 1 118 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
O82798 5.52e-07 52 36 3 88 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
O31517 5.68e-07 52 27 4 176 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
Q3LWR6 6.38e-07 52 21 4 202 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 6.38e-07 52 21 4 202 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 6.38e-07 52 21 4 202 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9KT84 6.67e-07 52 26 0 114 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P71403 6.69e-07 50 24 3 120 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM64 8.42e-07 50 24 3 120 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q8KIY1 8.84e-07 52 28 2 120 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q9HV27 1.04e-06 52 37 3 96 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AEV3 1.05e-06 52 28 0 101 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 1.05e-06 52 28 0 101 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 1.05e-06 52 28 0 101 3 rssB Regulator of RpoS Escherichia coli O157:H7
P43501 1.15e-06 49 31 1 104 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0AEC4 1.52e-06 52 29 1 117 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 1.52e-06 52 29 1 117 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
P58363 1.73e-06 51 29 1 117 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
A1W0A5 1.82e-06 48 25 4 132 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.82e-06 48 25 4 132 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.82e-06 48 25 4 132 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9KLK7 1.92e-06 51 28 2 128 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MM78 2.01e-06 51 26 0 114 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 2.01e-06 51 26 0 114 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q7G8V2 2.15e-06 50 32 2 89 1 ARR15 Two-component response regulator ARR15 Arabidopsis thaliana
E0X9C7 2.21e-06 51 27 2 120 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P46384 2.25e-06 48 24 1 116 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q68WH4 2.38e-06 51 30 1 103 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q53228 2.71e-06 49 29 0 106 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P0C0F6 2.76e-06 51 33 1 112 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A5W4E3 3.03e-06 50 27 2 120 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1RJS1 3.23e-06 50 31 1 103 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P26487 3.34e-06 49 27 0 118 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q940D0 4.22e-06 50 30 1 89 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P0C0F7 4.39e-06 50 33 1 112 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
Q5SML5 4.47e-06 50 28 2 123 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 4.59e-06 50 28 2 123 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
O82868 4.66e-06 48 28 0 110 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q3S4A7 4.76e-06 50 25 3 143 1 AHK5 Histidine kinase 5 Arabidopsis thaliana
O29221 6.19e-06 49 29 5 135 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9SB04 6.43e-06 48 36 1 63 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
P45671 6.93e-06 49 28 0 108 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P09432 7.32e-06 49 26 2 160 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q54Q69 8.07e-06 49 24 2 113 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
Q04848 8.1e-06 49 27 0 106 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9ZWS6 9.24e-06 48 31 1 72 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
Q8Z333 9.43e-06 49 30 0 101 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 9.61e-06 49 30 0 101 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
T2KMF4 9.84e-06 49 27 3 97 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
O80366 1.22e-05 48 28 3 110 1 ARR9 Two-component response regulator ARR9 Arabidopsis thaliana
Q8L9Y3 1.24e-05 48 26 1 121 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
P06628 1.48e-05 46 28 0 107 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P54302 1.53e-05 48 27 1 103 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
Q9KL96 1.57e-05 48 29 3 121 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P48027 1.84e-05 48 26 2 113 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q00934 1.88e-05 48 22 0 145 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZWS9 2.08e-05 47 32 2 75 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
P0AFU5 2.11e-05 48 31 0 100 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 2.11e-05 48 31 0 100 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q4L8V4 2.93e-05 47 24 5 146 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
A2X1N2 3.17e-05 47 31 5 127 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q2QXY3 3.21e-05 46 32 3 75 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 3.21e-05 46 32 3 75 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica
Q6H805 3.26e-05 47 31 5 127 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
P62598 3.27e-05 47 30 3 124 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q2RAP3 3.46e-05 46 32 3 75 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. japonica
Q4GZK2 3.46e-05 46 32 3 75 2 RR9 Two-component response regulator ORR9 Oryza sativa subsp. indica
P10576 3.65e-05 47 26 0 106 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
O49397 3.75e-05 47 27 2 119 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
P42508 3.78e-05 46 30 3 102 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
Q67W50 5.48e-05 47 28 2 121 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
P24072 5.66e-05 44 27 3 106 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
O32197 5.94e-05 46 25 6 211 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
P18769 6.5e-05 47 33 4 105 1 frzE Gliding motility regulatory protein Myxococcus xanthus
O07528 6.55e-05 45 29 3 105 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q8L500 6.89e-05 46 25 2 122 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
Q9FXD6 8.13e-05 46 28 4 124 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q6GK93 8.29e-05 45 30 3 120 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q2YV56 8.29e-05 45 30 3 120 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q56312 8.33e-05 44 22 1 115 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9KSB1 8.57e-05 46 25 1 100 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8NYJ9 8.85e-05 45 30 3 120 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 8.85e-05 45 30 3 120 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 8.85e-05 45 30 3 120 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 8.85e-05 45 30 3 120 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 8.85e-05 45 30 3 120 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q10WZ6 9.46e-05 46 33 6 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P9WGM3 0.000101 45 31 5 123 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 0.000101 45 31 5 123 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P24908 0.000104 45 28 1 107 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O25153 0.000106 46 27 4 109 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q869S5 0.000108 46 27 2 118 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
Q2YIF7 0.000114 43 23 0 115 1 cpdR Response regulator receiver protein CpdR Brucella abortus (strain 2308)
A2XE31 0.000134 45 26 3 130 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q8H7S7 0.000137 45 26 3 130 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
Q7CQM8 0.000158 44 27 2 113 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7A7X9 0.000175 45 30 3 120 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 0.000175 45 30 3 120 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P62646 0.000177 45 26 4 132 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P96686 0.000183 44 27 4 122 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q942A1 0.000198 44 29 1 75 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. japonica
Q4GZK7 0.000198 44 29 1 75 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. indica
P0DMC6 0.000198 45 27 0 118 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q8EQQ3 0.000206 44 28 1 81 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P58662 0.000221 45 28 0 105 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q56128 0.000232 45 28 0 105 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
G0SB31 0.000269 45 28 3 107 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q6K8X6 0.000293 45 27 2 121 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
P0DMC5 0.000297 45 28 0 105 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
O74539 0.000308 45 30 2 110 1 mak3 Peroxide stress-activated histidine kinase mak3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B8AEH1 0.00031 44 27 2 121 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
G7WMP8 0.000312 43 28 4 124 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
P0A4H5 0.00037 42 34 0 58 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 0.00037 42 34 0 58 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P52941 0.000372 43 30 4 117 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q9RC52 0.000381 43 30 0 79 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q4UU85 0.000394 44 32 1 83 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P52929 0.000409 43 32 1 76 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
A2XFB7 0.000429 44 25 2 124 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q10N34 0.000433 44 25 2 124 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
Q7WZY4 0.000451 43 24 8 223 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
Q9P896 0.000459 44 29 2 103 3 tcsA Two-component system protein A Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54YZ9 0.000501 44 23 2 115 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P0C5S3 0.000504 43 26 1 116 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
Q7MD16 0.000506 44 23 1 113 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q8D5Z6 0.00051 44 23 1 113 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q8D4U6 0.000592 43 33 2 92 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
Q8KR08 0.000592 43 20 0 101 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P52938 0.00064 43 25 5 140 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q75KW7 0.000645 42 27 4 109 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
Q5N6V8 0.000772 43 24 5 170 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q8CQE3 0.000782 43 27 3 121 3 SE_0165 Uncharacterized response regulatory protein SE_0165 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9ZWJ9 0.000811 43 29 1 78 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
P52931 0.00085 42 23 2 115 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P0A4H2 0.000861 42 26 1 116 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 0.000861 42 26 1 116 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 0.000861 42 26 1 116 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P15940 0.001 42 24 0 101 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2INJ8 0.001 43 29 2 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05665
Feature type CDS
Gene qseB
Product quorum sensing response regulator transcription factor QseB
Location 1204348 - 1205019 (strand: 1)
Length 672 (nucleotides) / 223 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2708
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07666 two-component system, OmpR family, response regulator QseB Two-component system
Quorum sensing
-

Protein Sequence

MRILLIEDDRLIGDGLKIGLTKLGFTIDWFTDGITGQQALFSAPYDAVILDLSLPGIDGLDILKQWRAQSRDEPVLILTARDALEQRVGGLQQGADDYLCKPFALAEVAARLQALIRRRHGQLSAKLAHGNVEMDPVAMTVTRNGVPVSLKGKELALLALFLNNPQKVLTRAMIEEKLYNWDEEVSSNAVEVHIHHLRRKLGREFIKTRHGIGYILGNDDENI

Flanking regions ( +/- flanking 50bp)

TGTGACTTCTGCGCTAAAACTACCACAGCGATACCCCGGGGATAAATATAATGCGAATTTTATTAATTGAAGATGACCGCCTGATTGGCGATGGATTGAAAATCGGGCTGACAAAACTCGGCTTCACTATAGATTGGTTCACTGATGGTATAACCGGGCAGCAGGCGCTGTTTTCCGCGCCTTATGATGCCGTGATCCTCGATCTGTCTCTGCCGGGTATTGACGGGCTGGATATTCTGAAACAGTGGCGGGCACAGAGCCGCGATGAACCGGTGCTGATTTTAACTGCCCGTGATGCGCTGGAGCAGCGGGTTGGCGGGTTACAGCAGGGAGCGGATGATTATCTGTGTAAGCCGTTTGCCCTGGCGGAAGTCGCTGCGCGCTTGCAGGCGCTGATCCGCCGCCGCCATGGTCAGCTATCCGCAAAACTGGCGCACGGCAATGTGGAGATGGACCCCGTCGCGATGACCGTCACCCGCAACGGCGTACCGGTTTCCCTGAAAGGAAAAGAACTCGCCCTGCTCGCGCTGTTTTTGAATAACCCGCAGAAAGTTCTCACCCGCGCCATGATTGAAGAAAAATTGTATAACTGGGATGAAGAGGTATCCAGCAATGCGGTCGAAGTGCATATCCATCATCTGCGCCGTAAATTAGGGCGGGAATTTATCAAAACACGCCACGGCATCGGCTATATTCTGGGTAATGATGATGAAAATATTTAGTCTGCGTCTGCGGCTGGGCGGCTTGCTGCTGTTGCTCTCCCTGATAACCT