Homologs in group_2585

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02885 FBDBKF_02885 77.0 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_03355 EHELCC_03355 77.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_00105 NLDBIP_00105 77.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_01930 LHKJJB_01930 77.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_01970 HKOGLL_01970 77.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Distribution of the homologs in the orthogroup group_2585

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2585

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACT9 1.04e-17 80 29 7 197 3 uidR HTH-type transcriptional regulator UidR Shigella flexneri
P0ACT6 1.04e-17 80 29 7 197 1 uidR HTH-type transcriptional regulator UidR Escherichia coli (strain K12)
P0ACT7 1.04e-17 80 29 7 197 3 uidR HTH-type transcriptional regulator UidR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACT8 1.04e-17 80 29 7 197 3 uidR HTH-type transcriptional regulator UidR Escherichia coli O157:H7
O53165 2.49e-10 60 23 2 160 1 Rv1474c HTH-type transcriptional repressor Rv1474c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8NQ97 2.97e-07 52 20 3 168 1 acnR HTH-type transcriptional repressor AcnR Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q88N29 4.27e-07 52 24 5 185 3 ttgR Probable HTH-type transcriptional regulator TtgR Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KJC4 4.27e-07 52 24 5 185 3 arpR Probable HTH-type transcriptional regulator ArpR Pseudomonas putida
Q4JVM3 1.02e-06 50 21 3 164 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium jeikeium (strain K411)
P95251 3.01e-06 50 32 0 65 1 mce3R Transcriptional repressor Mce3R Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9AIU0 3.07e-06 49 23 5 185 1 ttgR HTH-type transcriptional regulator TtgR Pseudomonas putida (strain DOT-T1E)
Q8FTA6 3.9e-06 48 22 3 162 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
O34643 5.61e-06 48 33 0 65 4 yvkB Uncharacterized HTH-type transcriptional regulator YvkB Bacillus subtilis (strain 168)
P0C068 5.77e-06 48 24 5 174 3 mepR Probable HTH-type transcriptional regulator MepR Pseudomonas putida
Q0S7V2 7.56e-06 48 28 4 130 1 kstR2 HTH-type transcriptional repressor KstR2 Rhodococcus jostii (strain RHA1)
Q8X4Z7 9.43e-06 48 41 0 51 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O157:H7
P0ACU4 9.99e-06 48 41 0 51 3 rutR HTH-type transcriptional regulator RutR Shigella flexneri
P0ACU2 9.99e-06 48 41 0 51 1 rutR HTH-type transcriptional regulator RutR Escherichia coli (strain K12)
P0ACU3 9.99e-06 48 41 0 51 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6NH62 1.71e-05 47 20 2 160 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
P29280 2.46e-05 47 28 4 108 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UI96 2.46e-05 47 28 4 108 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain PittGG)
A5UDB3 2.46e-05 47 28 4 108 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain PittEE)
Q4QLV2 2.46e-05 47 28 4 108 3 slmA Nucleoid occlusion factor SlmA Haemophilus influenzae (strain 86-028NP)
P17446 2.77e-05 46 38 0 50 2 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12)
B1J0W4 2.77e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XET8 2.77e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain K12 / DH10B)
Q0TKV9 3.4e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RFM1 3.43e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain UTI89 / UPEC)
B7MCD2 3.43e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0T7M8 3.67e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Shigella flexneri serotype 5b (strain 8401)
A7ZWV6 3.67e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O9:H4 (strain HS)
B7L442 3.67e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain 55989 / EAEC)
A7ZI52 3.67e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I093 3.71e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SE11)
B7M2V7 3.71e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O8 (strain IAI1)
Q8FKI7 3.74e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UJG6 3.74e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7N8L5 3.78e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q7MY26 3.8e-05 46 24 8 182 3 slmA Nucleoid occlusion factor SlmA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1LIJ9 4.04e-05 46 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli (strain SMS-3-5 / SECEC)
P0ACT1 4.05e-05 46 36 1 69 3 acrR HTH-type transcriptional regulator AcrR Shigella flexneri
P0ACS9 4.05e-05 46 36 1 69 1 acrR HTH-type transcriptional regulator AcrR Escherichia coli (strain K12)
P0ACT0 4.05e-05 46 36 1 69 3 acrR HTH-type transcriptional regulator AcrR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7NK49 4.12e-05 45 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Y006 4.16e-05 45 38 0 50 3 betI HTH-type transcriptional regulator BetI Klebsiella pneumoniae (strain 342)
B5Z1R2 4.16e-05 45 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X6C3 4.16e-05 45 38 0 50 3 betI HTH-type transcriptional regulator BetI Escherichia coli O157:H7
P94548 7.09e-05 45 33 0 53 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
Q65R67 8.69e-05 45 27 3 100 3 slmA Nucleoid occlusion factor SlmA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P40950 9.56e-05 45 36 0 50 4 yuxN Uncharacterized HTH-type transcriptional regulator YuxN Bacillus subtilis (strain 168)
O07001 0.000172 44 41 0 53 1 yvdT Uncharacterized HTH-type transcriptional regulator YvdT Bacillus subtilis (strain 168)
A8GBX7 0.000282 43 26 4 139 3 betI HTH-type transcriptional regulator BetI Serratia proteamaculans (strain 568)
B8F853 0.000411 43 27 3 107 3 slmA Nucleoid occlusion factor SlmA Glaesserella parasuis serovar 5 (strain SH0165)
Q66D52 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNP0 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pestis (strain Pestoides F)
Q1CFR9 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGV8 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pestis
B2K8U6 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C930 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKL4 0.000417 43 40 0 50 3 betI HTH-type transcriptional regulator BetI Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7VN48 0.000477 43 28 4 108 3 slmA Nucleoid occlusion factor SlmA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
O33453 0.000646 42 27 3 111 2 cymR HTH-type transcriptional regulator CymR Pseudomonas putida
A0R528 0.000662 42 28 2 69 1 kstR HTH-type transcriptional repressor KstR Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WMB9 0.000751 42 26 0 61 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 0.000751 42 26 0 61 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B0BTZ2 0.000878 42 28 4 108 3 slmA Nucleoid occlusion factor SlmA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H337 0.000878 42 28 4 108 3 slmA Nucleoid occlusion factor SlmA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3Q5 0.000878 42 28 4 108 3 slmA Nucleoid occlusion factor SlmA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7MFA6 0.001 42 34 0 50 3 betI HTH-type transcriptional regulator BetI Cronobacter sakazakii (strain ATCC BAA-894)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05330
Feature type CDS
Gene -
Product TetR/AcrR family transcriptional regulator
Location 1130961 - 1131563 (strand: -1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2585
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF13977 BetI-type transcriptional repressor, C-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16138 TetR/AcrR family transcriptional regulator, repressor for uid operon - -

Protein Sequence

MDKLTEKQRQKRRQILDAAMHCFIEKGFHSTSTAEICKAAGMSPGNLFHYYPTKYAIIEAIAELDSDDHKTILAMGDESGNTIDIIEKIVSALIALYNEPGYARISLEIITEASRNPELNTAFVVNEQKLHSKIRDVLHRGIAAGEIDSQLNPQQTASWLMVIAEGAMGRDLMEPAFNWKTSLAGLHVLIRKALIPNVAT

Flanking regions ( +/- flanking 50bp)

TAGAGTAATCAGTCTAACTTTTATTGTCCAGCTTTTCGGAGAATATTCTCATGGATAAATTAACGGAAAAGCAGCGCCAAAAACGCCGCCAGATCCTGGATGCAGCAATGCACTGCTTTATTGAAAAGGGGTTTCATTCGACATCAACAGCAGAAATCTGCAAAGCTGCAGGGATGAGCCCGGGTAACTTATTTCATTATTATCCGACGAAATACGCGATTATCGAAGCTATTGCAGAGCTGGACAGTGATGATCACAAGACCATTCTTGCCATGGGCGACGAATCCGGTAATACCATTGATATTATTGAAAAAATAGTGTCGGCGTTGATCGCACTTTATAATGAACCCGGCTATGCGCGCATCAGTCTGGAAATTATCACCGAGGCGAGCCGTAACCCGGAACTTAACACCGCATTTGTGGTAAACGAGCAAAAGTTACACAGTAAAATACGGGATGTATTGCACCGGGGAATTGCCGCCGGAGAGATTGATTCACAACTGAACCCGCAACAAACGGCATCCTGGCTGATGGTGATAGCAGAAGGTGCGATGGGCCGCGACCTGATGGAGCCTGCGTTTAACTGGAAAACCAGTCTTGCCGGGCTGCATGTTTTGATCAGAAAAGCGCTTATACCCAACGTCGCAACCTGAATGAATAAGGGTATCCTGAATAATCAGTCTGCTAATAGACGCTGCATAAT