Homologs in group_2580

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02850 FBDBKF_02850 85.3 Morganella morganii S1 fepD ABC-type Fe3+-siderophore transport system, permease component
EHELCC_03320 EHELCC_03320 85.3 Morganella morganii S2 fepD ABC-type Fe3+-siderophore transport system, permease component
NLDBIP_00140 NLDBIP_00140 85.3 Morganella morganii S4 fepD ABC-type Fe3+-siderophore transport system, permease component
LHKJJB_01895 LHKJJB_01895 85.3 Morganella morganii S3 fepD ABC-type Fe3+-siderophore transport system, permease component
HKOGLL_01935 HKOGLL_01935 85.3 Morganella morganii S5 fepD ABC-type Fe3+-siderophore transport system, permease component

Distribution of the homologs in the orthogroup group_2580

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2580

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q81L64 1.97e-50 181 32 7 358 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 8.13e-25 108 29 6 299 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q56992 2.95e-49 171 37 5 287 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
A6TAH6 2.95e-48 168 34 7 285 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
O34451 4.71e-48 168 37 6 305 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
P40411 2e-47 166 31 5 336 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
Q57552 4.03e-47 166 33 6 346 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8Z6I5 3.99e-46 162 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
B4T4N5 6.77e-46 162 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 6.77e-46 162 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 6.77e-46 162 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
B5BA35 7.29e-46 162 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 7.29e-46 162 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZPS8 1.08e-45 161 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 1.08e-45 161 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 1.08e-45 161 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 1.08e-45 161 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 1.08e-45 161 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 1.08e-45 161 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
Q57PU6 3.11e-45 160 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
A9MFB6 4.79e-45 160 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q57130 5.12e-45 160 35 3 283 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A8AHA4 6.5e-44 157 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3Z259 8.66e-44 156 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
Q32FI8 4.44e-43 155 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
P49937 4.76e-43 155 33 10 332 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
Q6D656 1.28e-42 154 34 7 283 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JPQ9 2.25e-42 153 34 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LQ78 6.05e-42 152 34 5 279 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P15029 2.03e-41 150 35 5 278 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
Q8FH26 3.58e-41 150 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1JJ25 4.46e-41 149 33 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 4.46e-41 149 33 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 4.46e-41 149 33 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 4.46e-41 149 33 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 4.46e-41 149 33 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 4.46e-41 149 33 8 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0T4S1 4.71e-41 149 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
B7M1C0 7.17e-41 149 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 7.17e-41 149 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N549 8.57e-41 149 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B6I8R6 9.03e-41 149 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
B2U360 9.13e-41 149 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7MVJ0 1.02e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
B7L6I4 1.13e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
B1IPL6 1.15e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 1.15e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
Q0THB7 1.19e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7C1M5 1.21e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
Q1RB84 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 1.39e-40 148 33 5 282 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 1.39e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US50 1.81e-40 148 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5YPZ9 5.38e-40 146 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 5.38e-40 146 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
P49936 2.33e-39 146 33 9 358 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
Q321G8 3.48e-39 144 33 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
Q7N3Q3 4.98e-39 144 34 7 281 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6LQ76 9.34e-38 140 34 5 291 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
Q9KSL2 4.81e-37 139 33 5 284 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O34933 5.24e-37 139 37 8 285 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
A8GDR2 2.66e-36 137 31 8 282 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
O31569 6e-35 134 29 7 328 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
Q7MLE7 1.09e-34 132 30 4 284 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q9HQ19 1.14e-34 133 35 5 288 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 1.14e-34 133 35 5 288 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8D927 1.16e-34 132 30 4 284 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
O31568 1.73e-34 132 31 8 334 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
O34832 3.58e-34 131 32 5 334 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
P15030 1.2e-32 127 29 6 305 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
Q9ZKW2 8.94e-32 125 32 4 312 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
O05731 9.22e-32 125 33 7 314 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
Q87Q39 9.66e-32 125 32 5 262 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q47085 1.51e-30 122 30 8 333 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
Q47086 1.12e-27 114 31 6 283 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
P23876 2.29e-27 113 33 8 307 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
P40410 4e-25 107 30 9 319 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
P06972 6.89e-25 109 27 6 292 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 3.17e-10 65 27 6 282 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P37738 8.63e-25 105 30 10 323 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
Q81XB1 1.31e-24 105 29 7 274 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
O87656 1.66e-24 108 27 6 292 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 8.38e-13 73 27 6 284 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2YX91 1.92e-24 105 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q58286 8.33e-24 103 25 6 302 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8NX64 6.9e-22 97 28 5 324 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 6.9e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
Q6GHV2 9.29e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 9.29e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 9.29e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 9.29e-22 97 28 5 324 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 9.29e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 9.29e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 9.29e-22 97 28 5 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
P94418 4.33e-21 95 28 9 313 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
P23877 6.87e-21 95 24 7 319 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q2FZE5 6.85e-19 89 28 6 324 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
P94419 5.45e-16 80 26 10 291 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q58287 8.2e-06 48 31 1 87 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05290
Feature type CDS
Gene -
Product iron ABC transporter permease
Location 1124417 - 1125481 (strand: -1)
Length 1065 (nucleotides) / 354 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2580
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0609 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-siderophore transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02015 iron complex transport system permease protein - -

Protein Sequence

MRDMVSNINRINKKKYQYQSILQLFFYLFILLAVMFFSLFYGSVNIEFHQKLTTVLKIVTGGINSKDLLPYETIIYNIRLPRIILVAVTGASLSLVGILMQTITRNELADPYILGVSSGASAGAVSAIVLGLFSSVSPYNIYIGAFAGGLISTSIIVLFNFKKSNMTNLVLIGIGISSLFSAITTAIIYLSKNESQVKSAMFWMLGSFSGIKWSYIWLPFVAMLVVLAFCLLFSNVLDTLLLGADASQQLGINVGAIKLCIIILSSFVVSIIVANVGVIAFIGLIIPHIVRNLISVKHFKLSLYSCLIGGAFLVIIDTISRSWFKPEEIPVGILTSLIGAPLFVYIIIKGNRSR

Flanking regions ( +/- flanking 50bp)

ATGCTGACAACGTGTTATGTGAATGTTTCATTAAATACAGGCTGATATATATGAGGGATATGGTAAGTAATATAAACAGGATAAATAAAAAGAAATATCAGTATCAGAGTATTTTACAGTTATTTTTTTACCTCTTTATTTTACTCGCTGTCATGTTTTTTTCACTGTTTTACGGCAGTGTCAATATAGAGTTTCATCAAAAACTGACAACTGTCCTTAAAATAGTCACCGGTGGAATAAACAGCAAAGACCTGTTGCCGTATGAAACGATTATTTATAATATCCGGTTGCCCCGGATAATTCTTGTTGCTGTCACCGGCGCATCATTATCATTGGTCGGTATTCTGATGCAGACCATTACCCGTAATGAACTGGCTGATCCTTATATTCTCGGCGTTTCTTCCGGTGCGAGTGCGGGAGCTGTTTCCGCGATTGTGCTGGGGTTATTCTCTTCTGTTTCACCTTATAATATCTATATTGGCGCCTTTGCGGGGGGATTGATTTCCACCTCCATTATTGTGTTATTTAACTTTAAAAAAAGTAATATGACAAACCTGGTGCTGATCGGGATAGGGATCTCCAGCCTTTTCTCTGCAATAACAACCGCGATTATTTATTTATCGAAAAATGAAAGTCAGGTGAAAAGTGCGATGTTCTGGATGCTGGGCAGTTTTTCAGGCATAAAATGGTCCTATATCTGGCTTCCGTTTGTTGCCATGCTGGTCGTGCTGGCATTCTGTCTTTTATTCAGTAATGTCCTTGATACACTGTTATTAGGCGCGGATGCTTCACAGCAGTTAGGTATTAATGTTGGTGCGATTAAATTATGTATCATCATTCTGTCTTCTTTTGTCGTCTCCATTATTGTTGCAAACGTCGGTGTTATTGCGTTTATCGGGCTGATTATTCCGCATATTGTCAGGAACCTTATTTCGGTTAAACATTTTAAGTTATCACTCTATTCCTGCCTGATCGGTGGCGCATTTTTAGTCATTATTGATACCATCTCCCGGAGCTGGTTTAAACCGGAAGAAATTCCGGTCGGGATACTTACTTCTTTAATTGGTGCGCCGTTGTTTGTTTATATCATTATCAAAGGAAACCGGAGCCGATAACATGAGTACTGTTGATGTTACTGACCTGAACTATAACGGAATACTGAAAG