Homologs in group_2580

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02850 FBDBKF_02850 100.0 Morganella morganii S1 fepD ABC-type Fe3+-siderophore transport system, permease component
NLDBIP_00140 NLDBIP_00140 100.0 Morganella morganii S4 fepD ABC-type Fe3+-siderophore transport system, permease component
LHKJJB_01895 LHKJJB_01895 100.0 Morganella morganii S3 fepD ABC-type Fe3+-siderophore transport system, permease component
HKOGLL_01935 HKOGLL_01935 100.0 Morganella morganii S5 fepD ABC-type Fe3+-siderophore transport system, permease component
F4V73_RS05290 F4V73_RS05290 85.3 Morganella psychrotolerans - iron ABC transporter permease

Distribution of the homologs in the orthogroup group_2580

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2580

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q81L64 1.07e-50 182 37 6 305 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 1.01e-25 111 29 8 320 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q56992 2.76e-50 174 36 3 284 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
Q57552 9.36e-48 167 33 5 337 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O34451 2.59e-47 166 33 6 355 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
Q57130 1.88e-45 161 35 3 283 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Z6I5 2.62e-45 160 35 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
B5BA35 3.49e-45 160 35 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 3.49e-45 160 35 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N5 4e-45 160 35 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 4e-45 160 35 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 4e-45 160 35 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
Q8ZPS8 6.37e-45 159 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 6.37e-45 159 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 6.37e-45 159 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 6.37e-45 159 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 6.37e-45 159 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 6.37e-45 159 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
A6TAH6 7.84e-45 159 33 6 284 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q57PU6 1.89e-44 158 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
A9MFB6 2.12e-44 158 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P40411 2.98e-44 158 30 6 347 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
A1JPQ9 1.1e-43 156 35 5 277 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJ25 1.14e-43 156 33 5 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 1.14e-43 156 33 5 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 1.14e-43 156 33 5 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 1.14e-43 156 33 5 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 1.14e-43 156 33 5 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 1.14e-43 156 33 5 279 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q32FI8 1.27e-43 156 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z259 1.7e-43 155 34 6 290 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
A8AHA4 6.41e-43 154 34 3 281 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8FH26 5.4e-41 149 34 4 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T4S1 5.45e-41 149 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
B7LQ78 5.51e-41 149 34 5 281 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I8R6 7.8e-41 149 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
B1IPL6 1.06e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 1.06e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
B2U360 1.07e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RB84 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 1.26e-40 148 34 4 289 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 1.26e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
Q7C1M5 1.43e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
P49937 1.46e-40 148 33 5 290 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
B7MVJ0 1.56e-40 148 34 4 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
B7M1C0 1.66e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 1.66e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
B7L6I4 1.7e-40 148 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
Q0THB7 1.83e-40 148 34 4 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N549 2.07e-40 147 34 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7US50 2.72e-40 147 34 4 291 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5YPZ9 3.22e-40 147 33 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 3.22e-40 147 33 4 289 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
Q6D656 3.5e-40 147 33 5 287 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P15029 6.87e-40 146 35 5 278 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
Q6LQ76 3.19e-39 144 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
Q321G8 3.74e-39 144 33 4 289 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
Q9KSL2 5.21e-38 141 33 5 285 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P49936 1.37e-36 139 37 7 288 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
Q8D927 1.63e-36 137 31 4 284 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
A8GDR2 1.99e-36 137 31 6 289 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
Q7MLE7 4.2e-36 136 30 4 284 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q7N3Q3 2.29e-35 134 33 7 281 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O34933 5.19e-34 131 35 9 287 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
Q87Q39 9.28e-34 130 33 5 262 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9HQ19 2.17e-33 130 33 7 324 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 2.17e-33 130 33 7 324 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O31569 3.42e-33 129 31 6 296 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
O34832 4.33e-31 123 35 6 287 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
O31568 4.65e-31 123 31 5 286 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
Q9ZKW2 6.06e-31 122 29 6 326 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
O05731 1.26e-30 122 29 6 326 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
P15030 3.55e-29 118 29 8 306 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
Q47085 2.06e-26 110 28 8 356 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
Q47086 6.38e-26 109 34 6 288 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
P23876 2.23e-25 107 32 5 285 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
P40410 7.17e-25 106 31 6 290 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
O87656 5.19e-24 106 27 7 295 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 1.99e-14 78 27 7 275 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23877 5.93e-24 103 25 7 332 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q58286 1.29e-23 103 25 9 320 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q81XB1 4.88e-23 101 30 7 272 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
P06972 3.42e-22 101 26 5 295 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 7.34e-11 67 27 8 276 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
Q2YX91 1.59e-21 97 27 6 324 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
P37738 1.48e-20 94 28 8 287 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
Q8NX64 1.68e-19 91 27 5 323 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 1.68e-19 91 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
P94418 1.87e-19 90 28 8 281 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
Q6GHV2 5.71e-19 89 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 5.71e-19 89 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 5.71e-19 89 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 5.71e-19 89 27 5 323 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 5.71e-19 89 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 5.71e-19 89 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 5.71e-19 89 27 5 323 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2FZE5 3.23e-16 81 26 6 323 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
P94419 4.05e-14 75 25 9 291 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q58287 9.39e-06 47 32 1 86 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03320
Feature type CDS
Gene fepD
Product ABC-type Fe3+-siderophore transport system, permease component
Location 652241 - 653305 (strand: -1)
Length 1065 (nucleotides) / 354 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2580
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0609 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-siderophore transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02015 iron complex transport system permease protein - -

Protein Sequence

MSEAVRETPVRRKKKLNGRNFSQFFICLSVLFAAMFFSLFYGSVNMEFHQKLDTVIKIISGGISGDDLLPYETIIYNIRLPRIILVAITGASLSLVGILMQTITRNELADPYILGVSSGASAGAVSAIVLGLFAFMSPYNVYIGAFAGGLISTAIIVLFNFKKSNMTNLVLIGIGISSLFSAITTAIIYLSKNESQVKSAMFWMLGSFSGIKWSYIPLPLVALIAVLIFCLLFSNVLDTLLLGADASAQLGVNVGAIKLAVIILSSFVVSIIVANVGVIAFIGLIIPHIVRNTIAVKHFKLSLYSCLVGGAFLVIIDTISRSWFKPEEIPVGILTSLIGAPLFVYIIIKANRSR

Flanking regions ( +/- flanking 50bp)

CCGTAAATCTGTTAACAGCCTCTGATCTGATGAAATACAGGTTAACAGTGATGAGTGAAGCAGTAAGAGAAACACCCGTGCGGCGTAAAAAGAAACTGAATGGCCGGAATTTTTCACAATTTTTTATCTGCCTGTCTGTGTTGTTTGCTGCCATGTTTTTTTCACTGTTTTACGGCAGCGTCAATATGGAATTTCATCAGAAGCTGGATACGGTAATCAAAATTATTAGCGGGGGCATCAGCGGTGATGATCTCCTGCCGTATGAAACCATCATTTATAATATCCGTCTGCCCCGGATTATCCTGGTGGCAATTACCGGCGCATCCCTGTCGCTGGTGGGGATCCTGATGCAGACCATAACCCGCAATGAACTGGCCGACCCGTATATTCTCGGGGTTTCCTCCGGTGCCAGCGCGGGGGCGGTATCTGCCATTGTGCTCGGGTTATTTGCTTTTATGTCACCGTATAATGTCTATATCGGTGCATTTGCCGGCGGGCTGATTTCCACTGCTATTATTGTCCTGTTTAATTTCAAAAAGAGCAATATGACCAATCTGGTGCTGATTGGTATCGGTATTTCCAGTCTGTTTTCTGCTATCACTACTGCCATTATTTATCTGTCCAAGAATGAAAGTCAGGTTAAAAGTGCAATGTTCTGGATGCTGGGCAGTTTCTCCGGTATTAAATGGTCTTATATCCCGCTGCCGCTGGTGGCATTAATTGCAGTATTAATTTTTTGTCTGTTATTCAGCAATGTGCTTGATACGTTATTGTTAGGTGCGGATGCATCAGCACAATTAGGTGTAAATGTCGGTGCCATCAAGCTGGCGGTGATTATTTTATCATCTTTTGTGGTTTCTATTATTGTGGCCAATGTCGGTGTGATTGCGTTTATCGGACTTATTATTCCGCATATTGTCCGTAATACGATTGCTGTGAAACATTTTAAGTTATCGCTCTATTCCTGCCTGGTCGGTGGTGCATTTCTGGTGATTATTGATACGATTTCCCGCAGCTGGTTTAAACCGGAGGAGATTCCGGTCGGTATTCTGACCTCACTGATAGGCGCGCCGCTGTTTGTTTATATCATTATTAAAGCGAACAGGAGCCGGTAACGTGAGTACTGTTGATATTAATGACCTGAATTATAACGGGATACTGAAAG