Homologs in group_2528

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01765 FBDBKF_01765 83.4 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_02235 EHELCC_02235 83.4 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_01225 NLDBIP_01225 83.4 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_00810 LHKJJB_00810 83.4 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_00850 HKOGLL_00850 83.4 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Distribution of the homologs in the orthogroup group_2528

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2528

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75952 2.98e-06 49 43 0 55 1 comR HTH-type transcriptional repressor ComR Escherichia coli (strain K12)
P32398 9.59e-06 48 28 2 103 4 yhgD Uncharacterized HTH-type transcriptional regulator YhgD Bacillus subtilis (strain 168)
O34619 1.37e-05 47 43 1 55 4 lmrA HTH-type transcriptional regulator LmrA Bacillus subtilis (strain 168)
P0ACU4 1.62e-05 47 41 0 56 3 rutR HTH-type transcriptional regulator RutR Shigella flexneri
P0ACU2 1.62e-05 47 41 0 56 1 rutR HTH-type transcriptional regulator RutR Escherichia coli (strain K12)
P0ACU3 1.62e-05 47 41 0 56 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X4Z7 1.65e-05 47 41 0 56 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O157:H7
Q8FTA6 2.04e-05 47 46 0 50 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8NQ97 2.81e-05 46 46 0 50 1 acnR HTH-type transcriptional repressor AcnR Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
O31560 3.86e-05 46 37 0 64 1 yfiR Uncharacterized HTH-type transcriptional regulator YfiR Bacillus subtilis (strain 168)
Q6NH62 6.9e-05 45 45 0 51 3 acnR HTH-type transcriptional repressor AcnR Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q88FX7 0.000246 44 32 1 81 2 nicS HTH-type transcriptional repressor NicS Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q93PU7 0.000298 42 28 5 128 1 ttgW Uncharacterized HTH-type transcriptional regulator TtgW Pseudomonas putida (strain DOT-T1E)
Q9R9T9 0.000593 43 27 5 133 1 srpR HTH-type transcriptional regulator SrpR Pseudomonas putida
Q7WY76 0.000605 42 37 0 54 4 yezE Uncharacterized HTH-type transcriptional regulator YezE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04095
Feature type CDS
Gene -
Product TetR/AcrR family transcriptional regulator
Location 866492 - 867127 (strand: -1)
Length 636 (nucleotides) / 211 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2528
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF14246 AefR-like transcriptional repressor, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Protein Sequence

MSSSPSPLTPKGQRRRHAILTAAADVFILHGYEGTTLDMIIEQSGGSRSTLYTSFGGKEALFLAVIEHLICGIFEDGKDTPDIAPEPEALLYDCGRRYLNSIVHPQSLGLYQLILAESQRFPQISERFYQAGPQRTSLQLATRLKTIPGIDASPEILQAVAARFLEMLKADLYLPVFSQRHEKPTAEFIEKQLPLSVEITACYIRHHLTCQ

Flanking regions ( +/- flanking 50bp)

CCGGCGTGGTTAAATCAGGGCTTATATCACTACCGGAGCCTGTTTCTGTTATGTCATCATCCCCGTCACCCTTAACCCCGAAAGGGCAGCGTCGCCGCCATGCTATCCTCACCGCCGCTGCAGATGTCTTTATTCTTCATGGCTACGAGGGAACGACACTGGATATGATTATTGAACAGTCAGGCGGGTCACGCTCCACACTTTATACCTCGTTCGGGGGAAAAGAAGCGCTGTTTCTGGCGGTGATCGAACACCTTATCTGCGGAATTTTTGAAGACGGGAAAGATACCCCGGATATTGCCCCGGAGCCGGAAGCACTGTTATACGACTGCGGCAGACGTTATCTGAACAGCATTGTTCATCCGCAATCACTCGGGCTGTATCAGTTGATTCTTGCGGAATCCCAGCGCTTTCCGCAAATCAGCGAGCGCTTTTATCAGGCAGGACCTCAGCGGACATCACTGCAATTAGCTACCCGCCTGAAAACTATCCCCGGGATAGATGCATCACCAGAGATATTACAGGCTGTCGCCGCGCGTTTTCTGGAAATGCTGAAAGCAGATCTTTATCTGCCGGTATTCAGTCAGCGCCATGAAAAACCCACTGCCGAATTTATTGAAAAACAACTGCCGTTATCCGTTGAGATAACGGCCTGCTATATTCGTCACCACCTGACCTGCCAATAAGCAGCGGTGACAATCAGCATCTGCGTTCAGCCATTCAGTTCAGCGGCTTT