Homologs in group_982

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05425 FBDBKF_05425 87.9 Morganella morganii S1 yeaC DUF1315 domain-containing protein
EHELCC_12165 EHELCC_12165 87.9 Morganella morganii S2 yeaC DUF1315 domain-containing protein
NLDBIP_12505 NLDBIP_12505 87.9 Morganella morganii S4 yeaC DUF1315 domain-containing protein
LHKJJB_12365 LHKJJB_12365 87.9 Morganella morganii S3 yeaC DUF1315 domain-containing protein
HKOGLL_10980 HKOGLL_10980 87.9 Morganella morganii S5 yeaC DUF1315 domain-containing protein
PMI_RS07280 PMI_RS07280 58.2 Proteus mirabilis HI4320 - DUF1315 family protein

Distribution of the homologs in the orthogroup group_982

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_982

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76231 7.16e-32 109 61 0 80 4 yeaC Uncharacterized protein YeaC Escherichia coli (strain K12)
P56607 2.78e-20 80 41 1 92 4 None Uncharacterized protein in dagA 3'region Pseudoalteromonas haloplanktis

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03870
Feature type CDS
Gene -
Product DUF1315 family protein
Location 819890 - 820165 (strand: 1)
Length 276 (nucleotides) / 91 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_982
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07023 Protein of unknown function (DUF1315)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3139 Function unknown (S) S Uncharacterized conserved protein YeaC, DUF1315 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09916 uncharacterized protein - -

Protein Sequence

MEIDDLLSAMTPEVYRRLVTAVELGKWADGVPLTESQKSSSLQLVMIWQSRHNEDPEHMTIGVNGEISLKSKQALKALFSDTHLATIRPQD

Flanking regions ( +/- flanking 50bp)

TTTGATGTAATCAAAAGGTAAAATCAGTCGTATTCGGGGAAGGAGTAAGAATGGAAATTGATGATTTGCTGTCCGCCATGACACCGGAAGTATACCGGCGCCTGGTGACCGCCGTCGAGTTAGGCAAATGGGCTGATGGCGTGCCGCTGACAGAATCACAGAAGAGCAGCAGCCTGCAACTGGTGATGATATGGCAGTCCCGTCATAACGAGGACCCGGAGCACATGACCATTGGTGTGAACGGGGAGATCAGCCTGAAATCCAAACAGGCGCTGAAAGCCCTGTTCAGTGATACACACCTGGCGACCATCCGGCCGCAGGACTGAGCACCAACCGGGACTGCGCAGAAATGCCGCTGTCCCGCGTCTGTCTTATC