Homologs in group_1885

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14090 FBDBKF_14090 77.9 Morganella morganii S1 menF Isochorismate synthase EntC
EHELCC_08190 EHELCC_08190 77.9 Morganella morganii S2 menF Isochorismate synthase EntC
NLDBIP_08515 NLDBIP_08515 77.9 Morganella morganii S4 menF Isochorismate synthase EntC
LHKJJB_05750 LHKJJB_05750 77.9 Morganella morganii S3 menF Isochorismate synthase EntC
HKOGLL_05165 HKOGLL_05165 77.9 Morganella morganii S5 menF Isochorismate synthase EntC
PMI_RS08570 PMI_RS08570 49.1 Proteus mirabilis HI4320 - isochorismate synthase

Distribution of the homologs in the orthogroup group_1885

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1885

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P38051 2.25e-118 355 48 5 418 1 menF Isochorismate synthase MenF Escherichia coli (strain K12)
P44613 1.38e-73 240 34 6 448 3 menF Isochorismate synthase MenF Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CPI5 6.95e-73 238 36 5 403 3 menF Isochorismate synthase MenF Pasteurella multocida (strain Pm70)
Q9S7H8 2.59e-39 152 31 5 341 1 ICS1 Isochorismate synthase 1, chloroplastic Arabidopsis thaliana
Q9ZPC0 1.58e-35 141 29 8 365 1 None Isochorismate synthase, chloroplastic Catharanthus roseus
P23973 3.94e-34 136 29 6 306 3 menF Isochorismate synthase MenF Bacillus subtilis (strain 168)
Q9M9V6 4.29e-32 131 31 4 299 1 ICS2 Isochorismate synthase 2, chloroplastic Arabidopsis thaliana
P23300 7.06e-32 128 32 3 255 3 amoA Putative isochorismate synthase Aeromonas hydrophila
Q51508 5.17e-26 113 33 6 269 1 pchA Salicylate biosynthesis isochorismate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45744 4.16e-25 109 29 5 272 1 dhbC Isochorismate synthase DhbC Bacillus subtilis (strain 168)
P0AEJ2 5.08e-24 106 29 5 260 1 entC Isochorismate synthase EntC Escherichia coli (strain K12)
P0AEJ3 5.08e-24 106 29 5 260 3 entC Isochorismate synthase EntC Escherichia coli O157:H7
O07898 6.52e-22 100 28 7 268 3 vibC Vibriobactin-specific isochorismate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9Z4W7 1.14e-19 94 30 7 266 3 trpE Anthranilate synthase component 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P05378 1.12e-18 91 30 8 270 3 trpE Anthranilate synthase component 1 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5V213 1.35e-18 91 28 7 262 3 trpE2 Anthranilate synthase component 1 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P56995 5.94e-18 89 26 9 316 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9XAZ0 7.07e-18 89 26 9 316 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9HPG5 1.19e-17 89 29 10 288 3 trpE1 Anthranilate synthase component 1 1 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O66849 1.23e-17 88 26 7 324 3 trpE Anthranilate synthase component 1 Aquifex aeolicus (strain VF5)
P26940 6.02e-17 86 29 7 279 3 trpE Anthranilate synthase component 1 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O27692 9.52e-17 85 29 7 264 3 trpE Anthranilate synthase component 1 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9S358 1.03e-16 85 26 9 316 3 trpE Anthranilate synthase component 1 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9WW00 8.2e-16 82 26 9 316 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae
Q5F8B4 8.2e-16 82 26 9 316 3 trpE Anthranilate synthase component 1 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P23315 9.05e-16 82 26 8 264 3 trpE Anthranilate synthase component 1 Acinetobacter calcoaceticus
Q06128 2.22e-15 81 25 8 287 1 trpE Anthranilate synthase component 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P96556 5.9e-15 80 30 9 255 3 trpE Anthranilate synthase component 1 Arthrobacter globiformis
Q08653 6.62e-15 80 26 11 306 3 trpE Anthranilate synthase component 1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P21690 1.31e-14 79 27 9 285 3 trpE Anthranilate synthase component 1 Spirochaeta aurantia
P28820 1.38e-14 79 26 8 286 1 pabB Aminodeoxychorismate synthase component 1 Bacillus subtilis (strain 168)
P9WFW9 8.92e-14 75 31 7 258 1 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFW8 8.92e-14 75 31 7 258 3 menF Putative isochorismate synthase MenF Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9YGB3 1.02e-13 76 25 7 256 3 trpE Anthranilate synthase component 1 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P21689 1.03e-13 76 26 7 244 3 trpE Anthranilate synthase component 1 Pseudomonas savastanoi
O28669 1.23e-13 75 26 8 259 3 trpE Anthranilate synthase component 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P20580 1.77e-13 75 26 7 244 1 trpE Anthranilate synthase component 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P18267 2.37e-13 75 27 10 286 3 trpE Anthranilate synthase component 1 Bacillus pumilus
Q02001 3.45e-13 74 27 9 264 3 trpE Anthranilate synthase component 1 Lactococcus lactis subsp. lactis (strain IL1403)
P74130 1.33e-12 73 29 4 207 3 trpE2 Anthranilate synthase component I-like protein Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P20579 2.45e-12 72 25 8 247 3 trpE Anthranilate synthase component 1 Pseudomonas putida
P9WFX3 2.5e-12 72 28 9 259 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX2 2.5e-12 72 28 9 259 1 trpE Anthranilate synthase component 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67002 2.5e-12 72 28 9 259 3 trpE Anthranilate synthase component 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q73XV3 3.29e-12 71 25 7 325 3 mbtI Salicylate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P33975 3.79e-12 71 28 10 266 3 trpE Anthranilate synthase component 1 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P03963 5.61e-12 71 26 8 265 3 trpE Anthranilate synthase component 1 Bacillus subtilis (strain 168)
Q9X6J4 1.43e-11 69 25 7 315 3 trpE Anthranilate synthase component 1 Geobacillus stearothermophilus
P05041 1.57e-11 69 28 4 202 1 pabB Aminodeoxychorismate synthase component 1 Escherichia coli (strain K12)
Q58475 1.69e-11 69 25 12 287 3 trpE Anthranilate synthase component 1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P20170 2.37e-11 69 27 13 296 3 trpE Anthranilate synthase component 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0QX93 6.02e-11 68 26 9 264 1 trpE Anthranilate synthase component 1 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P14953 8.41e-11 67 25 5 229 3 trpE Anthranilate synthase component 1 Acetivibrio thermocellus
Q5V448 1.09e-10 67 28 12 288 3 trpE1 Anthranilate synthase component 1 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
O94582 1.17e-10 67 24 7 269 1 trp3 Probable anthranilate synthase component 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P30526 1.59e-10 66 27 3 212 3 trpE Anthranilate synthase component 1 Bacillus caldotenax
Q9X7C5 3.11e-10 65 25 7 261 3 trpE Anthranilate synthase component 1 Mycobacterium leprae (strain TN)
P12680 4.15e-10 65 26 4 204 3 pabB Aminodeoxychorismate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A2XNK3 5.17e-10 65 29 10 254 3 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. indica
Q9XJ29 6.54e-10 64 28 8 255 1 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Oryza sativa subsp. japonica
P22099 7.86e-10 64 24 11 315 3 trpE Anthranilate synthase component 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q94GF1 9.57e-10 64 29 10 254 1 ASA1 Anthranilate synthase alpha subunit 1, chloroplastic Oryza sativa subsp. japonica
Q5Z856 1.04e-09 64 28 5 203 2 ADCS Probable aminodeoxychorismate synthase, chloroplastic Oryza sativa subsp. japonica
Q8GMH4 1.04e-09 63 27 7 239 1 sgcD 2-amino-4-deoxychorismate synthase Streptomyces globisporus
Q5V631 1.85e-09 63 27 7 241 3 trpE3 Anthranilate synthase component 1 3 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P32069 2.25e-09 63 26 12 319 2 ASA2 Anthranilate synthase alpha subunit 2, chloroplastic Arabidopsis thaliana
Q9KST2 2.75e-09 62 29 12 270 3 trpE Anthranilate synthase component 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P95646 2.89e-09 62 25 9 268 3 trpE Anthranilate synthase component 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9HS66 5.03e-09 62 29 7 243 3 trpE2 Anthranilate synthase component 1 2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9Y8T0 9.96e-09 60 27 12 300 3 trpE Anthranilate synthase component 1 Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
P00899 1.27e-08 60 25 7 274 1 TRP2 Anthranilate synthase component 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P27630 1.62e-08 60 26 8 257 3 pabB Aminodeoxychorismate synthase component 1 Streptomyces lividans
Q9ZER9 3.48e-08 59 25 10 276 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Pemphigus spyrothecae
Q6TAS3 1.82e-07 57 26 4 200 1 ADCS Aminodeoxychorismate synthase, chloroplastic Solanum lycopersicum
Q8LPN3 2.88e-07 56 23 8 275 1 ADCS Aminodeoxychorismate synthase, chloroplastic Arabidopsis thaliana
P9WFX1 4.51e-07 55 26 6 249 1 mbtI Salicylate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFX0 4.51e-07 55 26 6 249 3 mbtI Salicylate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TYQ1 4.51e-07 55 26 6 249 3 mbtI Salicylate synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P00895 6.18e-07 55 26 11 290 1 trpE Anthranilate synthase component 1 Escherichia coli (strain K12)
Q44598 2.02e-06 53 24 10 270 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schlechtendalia chinensis
P12679 2.42e-06 53 24 4 204 3 pabB Aminodeoxychorismate synthase component 1 Klebsiella aerogenes
Q89A29 2.89e-06 53 25 8 268 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P00898 3.69e-06 52 27 12 279 1 trpE Anthranilate synthase component 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P32483 3.87e-06 53 20 4 281 3 pabAB Aminodeoxychorismate synthase Streptomyces griseus
P00897 5.09e-06 52 27 11 287 1 trpE Anthranilate synthase component 1 Serratia marcescens
Q57527 1.6e-05 50 23 4 199 4 HI_1170 Uncharacterized PabA-like protein HI_1170 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P06557 1.92e-05 50 27 3 149 3 trpE Anthranilate synthase component 1 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P42387 2.16e-05 50 23 13 329 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P09785 4.08e-05 49 29 6 165 1 phnA Anthranilate synthase component 1, pyocyanine specific Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37254 8.72e-05 48 26 8 214 1 ABZ1 Aminodeoxychorismate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q44697 0.000101 48 24 9 274 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Diuraphis noxia
P43761 0.00013 48 25 12 277 3 trpE Anthranilate synthase component 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44691 0.000343 46 24 11 277 3 trpE Anthranilate synthase component 1 Buchnera aphidicola subsp. Rhopalosiphum padi
P50872 0.000427 46 24 7 235 4 trpE(G) Anthranilate synthase Azospirillum brasilense

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02845
Feature type CDS
Gene -
Product isochorismate synthase
Location 602094 - 603431 (strand: 1)
Length 1338 (nucleotides) / 445 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1885
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00425 chorismate binding enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1169 Coenzyme transport and metabolism (H)
Secondary metabolites biosynthesis, transport and catabolism (Q)		 HQ Isochorismate synthase EntC

Kegg Ortholog Annotation(s)

Protein Sequence

MILFSDFISQVCAEITHNKNETNGIYQYAVTLPPSLQAALPVTDWPGWLNGQICYPQFYWQHRDGTDIAAVCGELCRFTHINEAQAVLDTLPEQSNIRIWGLNSWQFDAISLTPEQGTGGSYLFIPRAELRCVQGNIQFLVNIDSRRPAEETVTFLRSLCGNVIPPVLETTVLSAEHQPDKAGWMQLVRTAVTAISGGLMEKVVTARKTVLRLSAPVRPLAFMQASRDCNHHCYHYMLATAPDNAFMASPPERLYLRTGAQLCTEALAGTVAGYPDDARAEAAARWLLADKKNVHENSVVVDDICQRLSGAVNTLKVSDATVIRLRKVQHLYRTISATLYTPRDNDCLQRLQPTAAVAGLPRTAALAFLRKNEPFERNWYAGSGGWCSPSQSEFAVSLRCAQIHGSQIDLYAGAGIVAGSDPQAEWNEIENKAAGLRTLLEGEPH

Flanking regions ( +/- flanking 50bp)

TCACCGTATAATCACCGTGACCCGCGTGTCTGACATATCCGGAGTAAGCAGTGATTCTTTTTTCTGATTTTATTTCTCAGGTTTGTGCTGAAATAACCCATAACAAAAATGAAACTAATGGTATTTATCAGTATGCCGTGACGCTGCCCCCGTCTTTGCAGGCAGCGCTGCCGGTGACGGATTGGCCGGGCTGGCTGAACGGGCAGATATGTTATCCGCAATTTTACTGGCAGCACCGCGACGGAACGGATATTGCGGCGGTGTGCGGCGAATTATGCCGCTTTACCCATATCAATGAGGCGCAGGCGGTACTCGATACATTGCCGGAGCAGAGCAATATCCGGATCTGGGGGCTGAACAGTTGGCAGTTTGATGCTATTTCCCTGACACCGGAGCAGGGAACAGGCGGCAGTTATCTGTTTATTCCGCGTGCGGAACTGCGCTGTGTGCAGGGCAACATTCAGTTTCTGGTCAATATCGACAGCCGCCGTCCGGCGGAAGAAACCGTGACCTTTCTGCGTTCGCTGTGCGGTAATGTTATCCCGCCGGTTCTTGAAACAACGGTGCTCAGTGCAGAGCATCAGCCTGATAAAGCCGGATGGATGCAACTGGTCCGCACGGCAGTGACCGCCATTTCCGGCGGTCTGATGGAAAAAGTGGTTACCGCGCGCAAAACAGTGCTCAGACTATCCGCACCGGTGCGCCCGCTGGCATTTATGCAGGCAAGCCGCGACTGCAATCACCACTGCTATCACTATATGCTGGCGACCGCACCGGATAATGCCTTTATGGCATCCCCGCCGGAGCGGCTCTATCTCAGAACCGGCGCACAGCTTTGTACTGAAGCCCTGGCTGGTACTGTGGCAGGCTACCCGGATGATGCCCGCGCAGAAGCCGCCGCGCGATGGCTTCTGGCTGATAAAAAAAATGTGCACGAAAATAGTGTGGTGGTTGATGATATTTGTCAGCGGCTGTCTGGTGCGGTAAATACACTGAAAGTGAGTGATGCCACCGTCATCCGTTTGCGCAAAGTTCAGCACCTTTACCGGACAATCTCTGCCACGTTATATACACCCCGTGACAACGATTGTTTACAGCGCCTTCAGCCGACGGCGGCGGTTGCCGGGCTTCCGCGTACAGCGGCACTGGCATTTTTGCGCAAAAATGAACCGTTTGAACGCAATTGGTATGCGGGCAGCGGCGGCTGGTGCAGTCCGTCACAAAGCGAATTTGCCGTATCACTGCGCTGCGCGCAAATTCACGGCAGTCAGATAGATTTGTATGCCGGAGCCGGTATTGTCGCGGGCTCTGATCCGCAGGCGGAATGGAACGAAATAGAAAATAAAGCGGCAGGGCTGCGGACATTGCTGGAGGGTGAGCCACACTGAGTGTGCCATATTCTGCTTATAGCCTGTCTGCATCCTGAATGACATCGGGT