Homologs in group_1929

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14350 FBDBKF_14350 95.6 Morganella morganii S1 smrB endonuclease SmrB
EHELCC_07930 EHELCC_07930 95.6 Morganella morganii S2 smrB endonuclease SmrB
NLDBIP_08255 NLDBIP_08255 95.6 Morganella morganii S4 smrB endonuclease SmrB
LHKJJB_06010 LHKJJB_06010 95.6 Morganella morganii S3 smrB endonuclease SmrB
HKOGLL_04905 HKOGLL_04905 95.6 Morganella morganii S5 smrB endonuclease SmrB
PMI_RS08850 PMI_RS08850 70.6 Proteus mirabilis HI4320 smrB endonuclease SmrB

Distribution of the homologs in the orthogroup group_1929

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1929

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N290 1.91e-94 275 69 0 176 3 plu3198 UPF0115 protein plu3198 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GH84 4.02e-93 271 68 0 176 3 Spro_3376 UPF0115 protein Spro_3376 Serratia proteamaculans (strain 568)
B4EZH2 1.01e-91 268 70 0 180 3 PMI1805 UPF0115 protein PMI1805 Proteus mirabilis (strain HI4320)
A1JK38 6.35e-91 266 67 0 176 3 YE1279 UPF0115 protein YE1279 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D2M4 3.29e-88 259 66 0 175 3 ECA3071 UPF0115 protein ECA3071 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DA87 3.67e-88 259 66 0 175 3 PC1_2813 UPF0115 protein PC1_2813 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A9R7W5 6.18e-88 258 70 0 167 3 YpAngola_A0379 UPF0115 protein YpAngola_A0379 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZD43 6.18e-88 258 70 0 167 3 YPO2749 UPF0115 protein YPO2749/y1583/YP_2414 Yersinia pestis
A7FGK4 6.18e-88 258 70 0 167 3 YpsIP31758_1403 UPF0115 protein YpsIP31758_1403 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A6TC17 1.51e-87 257 64 0 176 3 KPN78578_26770 UPF0115 protein KPN78578_26770 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XVW4 1.72e-87 257 65 0 176 3 KPK_1418 UPF0115 protein KPK_1418 Klebsiella pneumoniae (strain 342)
P67246 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67247 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella typhi
B4TQC0 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella schwarzengrund (strain CVM19633)
C0PZX8 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella paratyphi C (strain RKS4594)
A9N457 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZQ8 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella newport (strain SL254)
B4TCA6 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella heidelberg (strain SL476)
B5RCL1 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3R7 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella enteritidis PT4 (strain P125109)
B5FPM8 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella dublin (strain CT_02021853)
B5EZR7 1.16e-86 255 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella agona (strain SL483)
B5BBA3 3.71e-86 254 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella paratyphi A (strain AKU_12601)
Q5PCX4 3.71e-86 254 64 0 176 3 yfcN UPF0115 protein YfcN Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MJ39 6.48e-86 253 63 0 176 3 yfcN UPF0115 protein YfcN Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8ADP7 1.02e-85 253 63 0 176 3 CKO_00454 UPF0115 protein CKO_00454 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1LLT7 1.54e-85 252 64 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain SMS-3-5 / SECEC)
B7N5U3 1.54e-85 252 64 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q0TFB5 1.54e-85 252 64 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7LLD9 2.09e-85 252 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5YXX2 2.21e-85 252 64 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X5C4 2.21e-85 252 64 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O157:H7
B7LBI5 2.36e-85 252 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain 55989 / EAEC)
A4WCW4 2.84e-85 251 65 0 176 3 Ent638_2879 UPF0115 protein Ent638_2879 Enterobacter sp. (strain 638)
P0A8B4 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Shigella flexneri
Q0T2F4 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Shigella flexneri serotype 5b (strain 8401)
Q31YC7 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Shigella boydii serotype 4 (strain Sb227)
B2TWB3 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R981 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain UTI89 / UPEC)
B6I4X8 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain SE11)
P0A8B2 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain K12)
B1IXB4 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8B3 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A2K1 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O9:H4 (strain HS)
B1X9K4 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain K12 / DH10B)
C4ZVM4 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6L2 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O8 (strain IAI1)
B7MY08 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O81 (strain ED1a)
B7MG95 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFY9 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPE7 3.86e-85 251 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NP12 1.52e-84 249 63 0 176 3 yfcN UPF0115 protein YfcN Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q32DK6 2.46e-84 249 63 0 176 3 yfcN UPF0115 protein YfcN Shigella dysenteriae serotype 1 (strain Sd197)
Q3YZN0 7.76e-84 248 63 0 176 3 yfcN UPF0115 protein YfcN Shigella sonnei (strain Ss046)
B2VIX9 2.06e-77 231 60 0 176 3 ETA_11520 UPF0115 protein ETA_11520 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C4L8D4 2.59e-68 208 56 1 173 3 Tola_2181 UPF0115 protein Tola_2181 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q87MM7 2.84e-67 206 52 1 176 3 VP2204 UPF0115 protein VP2204 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MS57 7.86e-67 204 52 1 176 3 VIBHAR_03116 UPF0115 protein VIBHAR_03116 Vibrio campbellii (strain ATCC BAA-1116)
A0KKS9 4.15e-66 202 52 2 179 3 AHA_2357 UPF0115 protein AHA_2357 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7MIS9 5.9e-65 200 51 1 176 3 VV2436 UPF0115 protein VV2436 Vibrio vulnificus (strain YJ016)
B6EII1 1.46e-64 199 50 2 175 3 VSAL_I2166 UPF0115 protein VSAL_I2166 Aliivibrio salmonicida (strain LFI1238)
A5F6D7 2.11e-64 199 52 1 168 3 VC0395_A1701 UPF0115 protein VC0395_A1701/VC395_2233 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KQ82 2.11e-64 199 52 1 168 3 VC_2119 UPF0115 protein VC_2119 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LP68 2.11e-64 199 52 1 168 3 VCM66_2042 UPF0115 protein VCM66_2042 Vibrio cholerae serotype O1 (strain M66-2)
Q8DB44 3.62e-64 198 51 1 176 3 VV1_1979 UPF0115 protein VV1_1979 Vibrio vulnificus (strain CMCP6)
B5FGB1 4.61e-64 197 50 2 175 3 VFMJ11_1940 UPF0115 protein VFMJ11_1940 Aliivibrio fischeri (strain MJ11)
Q5E3U4 4.61e-64 197 50 2 175 3 VF_1807 UPF0115 protein VF_1807 Aliivibrio fischeri (strain ATCC 700601 / ES114)
P62430 2.47e-61 191 49 2 177 3 PBPRA0966 UPF0115 protein PBPRA0966 Photobacterium profundum (strain SS9)
Q7VL13 2.57e-55 175 52 4 174 3 HD_1679 UPF0115 protein HD_1679 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CNN6 8.56e-54 171 47 1 168 3 PM0391 UPF0115 protein PM0391 Pasteurella multocida (strain Pm70)
A6WQ16 6.79e-52 167 49 2 175 3 Shew185_2771 UPF0115 protein Shew185_2771 Shewanella baltica (strain OS185)
B8EEA5 6.79e-52 167 49 2 175 3 Sbal223_1605 UPF0115 protein Sbal223_1605 Shewanella baltica (strain OS223)
A3D678 7.66e-52 166 49 2 175 3 Sbal_2754 UPF0115 protein Sbal_2754 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KTV9 9.52e-52 166 49 2 175 3 Sbal195_2848 UPF0115 protein Sbal195_2848 Shewanella baltica (strain OS195)
A1RI98 1.41e-51 166 48 2 175 3 Sputw3181_1555 UPF0115 protein Sputw3181_1555 Shewanella sp. (strain W3-18-1)
A4Y891 4.58e-51 164 48 2 175 3 Sputcn32_2453 UPF0115 protein Sputcn32_2453 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
P59236 4.89e-51 164 48 2 175 3 SO_3081 UPF0115 protein SO_3081 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HKC5 5.22e-51 164 48 2 175 3 Shewmr4_1414 UPF0115 protein Shewmr4_1414 Shewanella sp. (strain MR-4)
A0KV82 9.82e-51 164 47 1 171 3 Shewana3_1467 UPF0115 protein Shewana3_1467 Shewanella sp. (strain ANA-3)
P44126 1.8e-50 163 49 2 166 3 HI_1202 UPF0115 protein HI_1202 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B8D704 2.04e-50 163 41 1 177 3 BUAPTUC7_097 UPF0115 protein BUAPTUC7_097 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57199 1.78e-49 161 41 1 177 3 BU098 UPF0115 protein BU098 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8Q0 1.78e-49 161 41 1 177 3 BUAP5A_096 UPF0115 protein BUAP5A_096 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9ZHE8 1.42e-42 143 41 0 174 3 BUsg_091 UPF0115 protein BUsg_091 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AX8 5.43e-39 134 36 2 174 3 bbp_092 UPF0115 protein bbp_092 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P76053 1.93e-06 49 23 3 178 1 smrA Probable DNA endonuclease SmrA Escherichia coli (strain K12)
B9DVK7 0.000116 45 32 0 76 3 mutS2 Endonuclease MutS2 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A3CKV4 0.000351 43 30 0 78 3 mutS2 Endonuclease MutS2 Streptococcus sanguinis (strain SK36)
O83680 0.000666 42 30 2 94 4 TP_0674 Uncharacterized protein TP_0674 Treponema pallidum (strain Nichols)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02555
Feature type CDS
Gene smrB
Product endonuclease SmrB
Location 540020 - 540565 (strand: -1)
Length 546 (nucleotides) / 181 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1929
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01713 Smr domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2840 Replication, recombination and repair (L) L DNA-nicking endonuclease, Smr domain

Protein Sequence

MKKKPPLTDDDLLLFKEAISGTRKIRQDNVVHPKPRANVTKIAPERLLQDQIDASFYFSDEYRPNLDMDGPTRYLRENASPYELKKLRRGDYVPELFLDLHGLTQLQAKQEIGALVAAARRENTYCVCIMHGHGKHVLKQQTPLWLAQHPDVIAFYQAPKEWGGTAALLLLIEIDETARRE

Flanking regions ( +/- flanking 50bp)

TCACTAAAGAAATCGGTTACACTATCGAAAATTATTTCTGATGAGATGTTATGAAAAAGAAGCCACCTTTAACCGATGACGACCTGCTGCTGTTTAAAGAAGCTATCAGCGGTACGCGTAAAATCAGGCAGGATAATGTGGTGCATCCGAAACCCCGGGCCAATGTAACCAAAATTGCTCCGGAGCGGCTGTTGCAGGATCAGATTGATGCCAGTTTTTATTTTTCGGATGAATACCGCCCGAATCTGGATATGGACGGCCCGACCCGCTATCTGCGCGAAAACGCCAGTCCGTATGAACTGAAAAAACTGCGCAGGGGTGATTATGTACCGGAACTGTTTCTTGATTTACACGGTTTAACGCAGCTTCAGGCCAAGCAGGAAATAGGCGCGCTGGTCGCGGCTGCCCGCCGCGAAAATACCTATTGTGTCTGTATCATGCACGGGCACGGTAAACATGTTCTGAAACAACAGACACCGCTGTGGCTGGCACAACACCCGGATGTCATTGCATTTTACCAGGCACCAAAAGAATGGGGCGGCACCGCTGCATTACTGCTGCTTATCGAAATTGACGAAACCGCCCGGCGTGAATAATCAGGCTAACTGACCCGGAGCGCGGTGCCAGCACAATGTACCGCAACCGT