Homologs in group_566

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01465 FBDBKF_01465 75.3 Morganella morganii S1 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
EHELCC_00080 EHELCC_00080 75.3 Morganella morganii S2 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
NLDBIP_03380 NLDBIP_03380 75.3 Morganella morganii S4 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
LHKJJB_04895 LHKJJB_04895 75.3 Morganella morganii S3 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
HKOGLL_02150 HKOGLL_02150 75.3 Morganella morganii S5 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
PMI_RS09355 PMI_RS09355 51.8 Proteus mirabilis HI4320 - tRNA1(Val) (adenine(37)-N6)-methyltransferase

Distribution of the homologs in the orthogroup group_566

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_566

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8GI34 2.55e-96 285 56 2 246 3 Spro_3678 tRNA1(Val) (adenine(37)-N6)-methyltransferase Serratia proteamaculans (strain 568)
B1JRB8 2.47e-94 280 55 1 238 3 YPK_1180 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q7N1W7 9.62e-94 278 55 1 238 3 plu3348 tRNA1(Val) (adenine(37)-N6)-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q667U2 1.29e-93 278 54 1 238 3 YPTB2899 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q74SR9 1.29e-93 278 54 1 238 3 YPO2709 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis
B2KA56 1.29e-93 278 54 1 238 3 YPTS_3010 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TKY7 1.45e-93 278 54 1 238 3 YPDSF_1562 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CKF3 1.45e-93 278 54 1 238 3 YPN_1197 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3Z3 1.45e-93 278 54 1 238 3 YpAngola_A3602 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q1C564 1.45e-93 278 54 1 238 3 YPA_2443 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFT0 1.45e-93 278 54 1 238 3 YpsIP31758_1127 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JKJ4 4.02e-91 271 55 1 238 3 YE1008 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4F055 1.48e-88 265 52 2 242 3 PMI1896 tRNA1(Val) (adenine(37)-N6)-methyltransferase Proteus mirabilis (strain HI4320)
Q6D211 8.21e-84 253 52 1 238 3 ECA3286 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DC08 2.26e-81 247 52 1 242 3 PC1_3079 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XNG1 2.65e-77 236 48 1 244 3 KPK_1222 tRNA1(Val) (adenine(37)-N6)-methyltransferase Klebsiella pneumoniae (strain 342)
A6TCI9 4e-77 236 48 1 244 3 KPN78578_28490 tRNA1(Val) (adenine(37)-N6)-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5RD57 3.04e-76 234 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTV6 3.04e-76 234 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q8ZMX8 3.39e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0PVY6 3.39e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi C (strain RKS4594)
B5BAS2 4.17e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi A (strain AKU_12601)
A9N0W9 4.17e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNB8 4.17e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z4J9 4.26e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella typhi
Q57L59 7.74e-76 233 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella choleraesuis (strain SC-B67)
A9MGW2 1.44e-75 232 49 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C6CB42 1.11e-74 230 47 3 248 3 Dd703_2793 tRNA1(Val) (adenine(37)-N6)-methyltransferase Musicola paradisiaca (strain Ech703)
A7MH06 1.91e-74 229 49 1 244 3 ESA_00683 tRNA1(Val) (adenine(37)-N6)-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B7LUY9 1.2e-73 227 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WDE6 1.33e-73 227 49 2 246 3 Ent638_3062 tRNA1(Val) (adenine(37)-N6)-methyltransferase Enterobacter sp. (strain 638)
Q8XA22 5.72e-73 225 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O157:H7
Q32CU6 2.63e-72 224 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
C6UQY1 2.77e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5Z149 2.77e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q3YYU0 2.87e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella sonnei (strain Ss046)
Q31XR1 4.94e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TYI8 4.94e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q83QI2 5.16e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella flexneri
Q0T1T1 5.16e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B6I5E9 5.16e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain SE11)
B7M8I9 5.16e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O8 (strain IAI1)
B1LP88 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7N6G4 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P31825 5.45e-72 223 46 1 244 1 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain K12)
B1IVQ2 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A386 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O9:H4 (strain HS)
B1XBQ2 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZYJ8 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
C6UBI3 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain B / REL606)
C5W7S9 5.45e-72 223 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain B / BL21-DE3)
A8AD10 5.51e-72 223 47 2 246 3 CKO_00207 tRNA1(Val) (adenine(37)-N6)-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LDG8 1.12e-71 222 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZQ20 1.12e-71 222 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R8F7 2.27e-71 221 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain UTI89 / UPEC)
Q8FF14 2.27e-71 221 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AEA5 2.27e-71 221 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O1:K1 / APEC
B7MIR0 2.27e-71 221 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH15 2.27e-71 221 46 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
C6CNL2 3.79e-71 221 47 3 253 3 Dd1591_1060 tRNA1(Val) (adenine(37)-N6)-methyltransferase Dickeya chrysanthemi (strain Ech1591)
B7MYK8 3.95e-71 221 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O81 (strain ED1a)
B2VI36 6.11e-71 220 46 1 244 3 ETA_09820 tRNA1(Val) (adenine(37)-N6)-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7NRM8 6.45e-71 220 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q0TER3 1.16e-70 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C4LCN4 1.15e-65 206 44 1 233 3 Tola_0970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6LD46 1.17e-64 204 44 3 234 3 BDI_1875 tRNA1(Val) (adenine(37)-N6)-methyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A0KPC4 2.75e-63 200 45 1 237 3 AHA_3669 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C5BAI6 1.83e-62 199 47 3 238 3 NT01EI_3041 tRNA1(Val) (adenine(37)-N6)-methyltransferase Edwardsiella ictaluri (strain 93-146)
Q65W50 5.12e-61 195 41 3 247 3 MS0203 tRNA1(Val) (adenine(37)-N6)-methyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C6AQR4 8.65e-60 191 43 3 235 3 NT05HA_1847 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aggregatibacter aphrophilus (strain NJ8700)
Q5LCS1 2.63e-59 190 42 1 233 3 BF2394 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A4SRS5 3.86e-59 190 45 2 237 3 ASA_3636 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas salmonicida (strain A449)
Q9CJZ9 4.48e-59 189 41 2 240 3 PM1839 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pasteurella multocida (strain Pm70)
Q64TX7 4.94e-59 189 42 1 233 3 BF2305 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides fragilis (strain YCH46)
Q119M4 2.3e-58 188 43 2 235 3 Tery_0325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Trichodesmium erythraeum (strain IMS101)
B0UWL8 3.38e-58 187 39 2 238 3 HSM_0322 tRNA1(Val) (adenine(37)-N6)-methyltransferase Histophilus somni (strain 2336)
Q0I4T7 1.16e-57 186 39 2 238 3 HS_1296 tRNA1(Val) (adenine(37)-N6)-methyltransferase Histophilus somni (strain 129Pt)
A6VKA4 2.41e-57 185 43 3 237 3 Asuc_0019 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A6GWI6 1e-56 184 40 3 234 3 FP0346 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8A9H7 5.23e-56 182 42 1 232 3 BT_0838 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A5UA66 3.2e-55 179 40 3 235 3 CGSHiEE_00885 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittEE)
A6L532 3.25e-55 179 43 2 233 3 BVU_3164 tRNA1(Val) (adenine(37)-N6)-methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q4QNC1 4.83e-55 179 40 3 235 3 NTHI0547 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain 86-028NP)
B8F678 2.23e-54 177 40 5 240 3 HAPS_1234 tRNA1(Val) (adenine(37)-N6)-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
A5UGT6 2.51e-54 177 40 3 234 3 CGSHiGG_05325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittGG)
A5FKD7 4.33e-54 177 40 4 235 3 Fjoh_1299 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q15NR8 1.47e-53 176 38 5 262 3 Patl_3970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P44702 1.52e-53 175 40 3 234 3 HI_0423 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3N3J4 6.68e-53 174 37 2 236 3 APL_1900 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H2W9 6.98e-53 174 37 2 236 3 APP7_1987 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A0LXM6 8.75e-53 174 38 3 235 3 GFO_0132 tRNA1(Val) (adenine(37)-N6)-methyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q7MNQ4 2.65e-52 172 41 4 242 3 VV0662 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain YJ016)
A7MXM2 4.75e-52 172 40 3 235 3 VIBHAR_00953 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q8DEQ3 7.16e-52 171 40 4 242 3 VV1_0533 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain CMCP6)
Q3IG80 8.18e-51 168 38 3 234 3 PSHAa0511 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q87SB8 3.44e-50 167 42 3 235 3 VP0506 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LSR6 6.02e-50 166 40 3 235 3 VCM66_0619 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU62 6.02e-50 166 40 3 235 3 VC_0661 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C6VS84 1.79e-48 162 37 4 243 3 Dfer_5119 tRNA1(Val) (adenine(37)-N6)-methyltransferase Dyadobacter fermentans (strain ATCC 700827 / DSM 18053 / CIP 107007 / KCTC 52180 / NS114)
B6EMW5 4.63e-45 154 38 5 238 3 VSAL_I0559 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio salmonicida (strain LFI1238)
B7VJ58 2.11e-44 152 37 4 245 3 VS_0507 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio atlanticus (strain LGP32)
A8H0P3 2.64e-44 152 36 5 266 3 Spea_0803 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KF36 3.48e-44 152 36 3 244 3 Swoo_0893 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
A8FRM9 4.21e-44 151 35 3 245 3 Ssed_0891 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sediminis (strain HAW-EB3)
Q6LUN9 1.98e-43 150 37 2 237 3 PBPRA0563 tRNA1(Val) (adenine(37)-N6)-methyltransferase Photobacterium profundum (strain SS9)
Q8EI95 3.38e-43 149 38 4 239 3 SO_0948 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8CU29 5.24e-43 149 37 3 240 3 swp_4230 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q0HRP2 6.38e-43 148 37 3 236 3 Shewmr7_3230 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain MR-7)
Q0HM44 1.63e-42 147 37 3 236 3 Shewmr4_0793 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain MR-4)
Q087P4 2.15e-42 147 35 2 249 3 Sfri_0661 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella frigidimarina (strain NCIMB 400)
A3QAZ2 1.39e-41 145 38 4 245 3 Shew_0768 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C6Y2G0 8.23e-41 143 35 2 237 3 Phep_2972 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)
B0TUD3 2.1e-40 142 36 5 249 3 Shal_0858 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella halifaxensis (strain HAW-EB4)
A0L0I8 3.31e-40 141 35 3 241 3 Shewana3_3333 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain ANA-3)
Q5E7Q6 7.73e-39 137 37 3 235 3 VF_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1RN54 4.44e-38 136 34 4 238 3 Sputw3181_3285 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain W3-18-1)
A4Y3T4 1.28e-37 134 34 5 240 3 Sputcn32_0888 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B5F9T8 5.94e-37 133 36 3 235 3 VFMJ11_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain MJ11)
Q12R91 1.84e-36 132 30 2 263 3 Sden_0745 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6WS64 9.77e-36 130 34 6 245 3 Shew185_3526 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS185)
A9L1L1 1.74e-35 129 34 6 245 3 Sbal195_3645 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS195)
A3D0V3 4.31e-35 128 34 6 245 3 Sbal_0841 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E5T2 4.31e-35 128 34 6 245 3 Sbal223_3451 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS223)
C6X2D2 1.34e-34 127 35 3 201 3 FIC_02159 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacteriaceae bacterium (strain 3519-10)
A1S987 2.36e-33 123 35 2 234 3 Sama_2741 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q11RK8 3.7e-31 118 33 5 236 3 CHU_2705 tRNA1(Val) (adenine(37)-N6)-methyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q7MVG0 6.21e-31 118 43 3 167 3 PG_1104 tRNA1(Val) (adenine(37)-N6)-methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RK25 2.76e-30 116 42 3 167 3 PGN_1201 tRNA1(Val) (adenine(37)-N6)-methyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
P37543 2.68e-09 59 30 3 123 3 yabB Probable RNA methyltransferase YabB Bacillus subtilis (strain 168)
Q8ECQ4 8.17e-09 58 35 6 142 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2RFW1 1.88e-08 57 32 4 161 3 prmC Release factor glutamine methyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q748B2 2.46e-08 57 34 7 149 3 prmC Release factor glutamine methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q89DG5 9.61e-08 55 34 7 134 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9KQ83 1.02e-07 55 40 4 88 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5F783 1.78e-07 54 33 5 139 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P39200 2.6e-07 53 39 4 88 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio anguillarum (strain ATCC 68554 / 775)
Q8A1D7 2.92e-07 53 33 6 148 3 prmC Release factor glutamine methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q9JYC0 4.23e-07 53 33 5 139 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JTA1 4.52e-07 53 33 5 139 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5E3U5 5.95e-07 53 38 4 88 3 prmB Ribosomal protein uL3 glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7NJS7 5.13e-06 50 31 6 136 3 prmC Release factor glutamine methyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7W022 7.15e-06 49 39 3 89 3 prmC Release factor glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q32DK7 8.05e-06 49 34 5 136 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q1II29 8.58e-06 49 39 4 87 3 prmC Release factor glutamine methyltransferase Koribacter versatilis (strain Ellin345)
Q921L7 1.01e-05 49 37 2 83 2 Hemk1 MTRF1L release factor glutamine methyltransferase Mus musculus
Q68VR6 1.05e-05 49 28 5 150 3 prmC/trmB Bifunctional methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9A9T7 1.32e-05 48 31 7 158 3 prmC Release factor glutamine methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9CNN7 1.67e-05 48 24 7 219 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pasteurella multocida (strain Pm70)
Q9PDL1 1.89e-05 48 34 3 90 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
P39199 2.28e-05 48 33 5 136 1 prmB Ribosomal protein uL3 glutamine methyltransferase Escherichia coli (strain K12)
Q87DS5 2.63e-05 48 34 3 90 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q63SZ9 2.75e-05 48 31 4 133 3 prmB Ribosomal protein uL3 glutamine methyltransferase Burkholderia pseudomallei (strain K96243)
Q8EAR4 3.3e-05 47 37 3 89 3 prmC Release factor glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8DHV7 4.3e-05 47 32 5 151 3 prmC Release factor glutamine methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P0A293 5.03e-05 47 33 5 136 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A294 5.03e-05 47 33 5 136 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhi
Q9PD67 5.37e-05 47 34 5 121 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
Q8KCD5 5.78e-05 47 32 5 137 3 prmC Release factor glutamine methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q0WDE1 7.47e-05 46 38 3 80 3 prmB Ribosomal protein uL3 glutamine methyltransferase Yersinia pestis
Q7ULT2 8.1e-05 46 35 2 80 3 prmC Release factor glutamine methyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q87DF7 8.76e-05 46 34 5 121 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9I347 8.84e-05 46 36 3 88 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8R619 9.93e-05 46 34 2 81 3 prmC Release factor glutamine methyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P74003 0.000135 45 37 2 87 3 prmC Release factor glutamine methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DPZ3 0.000191 45 40 4 80 3 prmC Release factor glutamine methyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q9Y5R4 0.000208 45 38 2 81 1 HEMK1 MTRF1L release factor glutamine methyltransferase Homo sapiens
Q9CHX0 0.000227 45 37 3 80 3 prmC Release factor glutamine methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
Q81JX2 0.000228 45 25 8 199 3 prmC Release factor glutamine methyltransferase Bacillus anthracis
P40816 0.000248 45 31 6 145 3 prmC Release factor glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6H162 0.000466 44 27 4 116 3 prmC Release factor glutamine methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q9WYV8 0.000488 44 32 3 83 1 prmC Release factor glutamine methyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7VXJ6 0.000717 43 32 6 143 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q32GZ5 0.000833 43 35 3 87 3 prmC Release factor glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01940
Feature type CDS
Gene -
Product tRNA1(Val) (adenine(37)-N6)-methyltransferase
Location 424306 - 425049 (strand: 1)
Length 744 (nucleotides) / 247 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_566
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05175 Methyltransferase small domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4123 Translation, ribosomal structure and biogenesis (J) J tRNA1(Val) A37 N6-methylase TrmN6

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15460 tRNA1Val (adenine37-N6)-methyltransferase [EC:2.1.1.223] - -

Protein Sequence

MMTENNSTPRRRGFTFKQFFVAHDRCAMKVGTDGVLLGGWVPCEHARHILDIGTGSGLVALMLAQRAMAEALIDAVDIDEGAYLQALENTQASPWAVRMQVFHLDIGEFLSAYPQKRYDLIVSNPPYFLPAVACRDSARETARYTASLDHRTLLHTAEQLLTPDGLLCVVLPYDIGQAFIAAGNEQSWFLHSQVAVSDKPDTPFHRILIALSRRAVTAQTRAMSIKTQDGQYSNDFKAFISGFYLKY

Flanking regions ( +/- flanking 50bp)

GTATCCTGTCGGACAGATTTTTCTCTATTTTATCATATAGCAGCGCAATAATGATGACAGAAAATAATTCCACTCCGCGCCGTCGCGGTTTTACCTTTAAACAGTTTTTTGTCGCCCATGACCGGTGCGCAATGAAGGTCGGCACCGATGGTGTTTTACTGGGCGGCTGGGTACCGTGTGAGCACGCCCGGCACATTCTGGATATCGGTACCGGCAGCGGGCTGGTGGCACTGATGCTGGCACAACGGGCGATGGCGGAGGCACTGATTGATGCGGTGGATATTGATGAAGGCGCGTACTTACAGGCGCTGGAAAATACACAGGCATCACCTTGGGCGGTACGGATGCAGGTCTTTCATCTGGATATCGGCGAATTTCTCAGTGCGTATCCGCAGAAACGCTATGATCTGATTGTCAGTAACCCGCCCTATTTTTTACCCGCCGTGGCTTGCCGCGACAGTGCGCGTGAAACGGCGCGCTATACCGCATCGCTGGATCACCGCACGCTTTTGCACACAGCGGAGCAACTGCTGACACCTGACGGATTGCTGTGTGTGGTGCTGCCTTATGATATCGGACAGGCGTTTATCGCGGCAGGAAATGAACAGAGCTGGTTTCTGCATTCACAGGTGGCGGTGTCAGATAAACCGGATACCCCGTTTCACCGCATACTGATAGCGTTATCCCGCCGGGCGGTTACGGCACAAACCCGGGCAATGAGCATCAAAACACAGGACGGTCAGTATAGTAATGATTTCAAAGCGTTTATCAGCGGATTTTATCTGAAATACTAAACCGGTCTGTCATATCGGATGTGGCAGCGGCTTTTCCGGTTTAAAATGGA