Homologs in group_1267

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07015 FBDBKF_07015 97.1 Morganella morganii S1 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
EHELCC_03955 EHELCC_03955 97.1 Morganella morganii S2 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
NLDBIP_03955 NLDBIP_03955 97.1 Morganella morganii S4 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
LHKJJB_09785 LHKJJB_09785 97.1 Morganella morganii S3 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
HKOGLL_09190 HKOGLL_09190 97.1 Morganella morganii S5 hisJ ABC-type amino acid transport/signal transduction system, periplasmic component/domain
PMI_RS03350 PMI_RS03350 73.8 Proteus mirabilis HI4320 artJ arginine ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_1267

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1267

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P30859 2.3e-122 350 65 1 244 1 artI Putative ABC transporter arginine-binding protein 2 Escherichia coli (strain K12)
P30860 2.73e-109 317 59 1 243 1 artJ ABC transporter arginine-binding protein 1 Escherichia coli (strain K12)
P45091 5.49e-76 233 47 2 242 1 artI ABC transporter arginine-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P49618 1.65e-71 221 47 4 242 3 lapT Arginine-binding periplasmic protein Mannheimia haemolytica
P0AEU0 1.52e-55 181 40 4 229 1 hisJ Histidine-binding periplasmic protein Escherichia coli (strain K12)
P0AEU1 1.52e-55 181 40 4 229 3 hisJ Histidine-binding periplasmic protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU2 1.52e-55 181 40 4 229 3 hisJ Histidine-binding periplasmic protein Escherichia coli O157:H7
P02910 1.67e-55 181 41 4 229 1 hisJ Histidine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P09551 4.17e-51 170 36 6 254 1 argT Lysine/arginine/ornithine-binding periplasmic protein Escherichia coli (strain K12)
G3XD47 1.49e-49 166 37 3 231 1 aotJ L-arginine-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P02911 2.29e-49 165 36 6 254 1 argT Lysine/arginine/ornithine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P35120 1.56e-43 151 31 5 268 1 nocT Nopaline-binding periplasmic protein Agrobacterium fabrum (strain C58 / ATCC 33970)
P0AEQ3 6.05e-38 135 34 5 245 1 glnH Glutamine-binding periplasmic protein Escherichia coli (strain K12)
P0AEQ4 6.05e-38 135 34 5 245 3 glnH Glutamine-binding periplasmic protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ5 6.05e-38 135 34 5 245 3 glnH Glutamine-binding periplasmic protein Escherichia coli O157:H7
P54535 2.46e-36 132 37 9 257 1 artP Arginine-binding extracellular protein ArtP Bacillus subtilis (strain 168)
P0A4F8 1.93e-34 127 31 7 272 1 occT Octopine-binding periplasmic protein Rhizobium radiobacter
P0A4F9 1.93e-34 127 31 7 272 3 occT Octopine-binding periplasmic protein Agrobacterium tumefaciens (strain Ach5)
Q06758 2.56e-32 122 33 4 233 3 hisJ Probable histidine-binding protein Neisseria gonorrhoeae
P0AEM9 1.08e-31 120 30 4 228 1 tcyJ L-cystine-binding protein TcyJ Escherichia coli (strain K12)
P0AEN0 1.08e-31 120 30 4 228 3 tcyJ L-cystine-binding protein TcyJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P72298 8.17e-31 118 28 7 288 3 occT Octopine-binding periplasmic protein Rhizobium meliloti
Q9Z869 5.78e-30 115 31 4 219 1 artJ Probable ABC transporter arginine-binding protein ArtJ Chlamydia pneumoniae
O34563 1.44e-27 109 30 5 234 2 glnH ABC transporter glutamine-binding protein GlnH Bacillus subtilis (strain 168)
Q46125 9.69e-24 99 31 7 222 1 hisJ Probable histidine-binding protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P39906 2.43e-22 95 32 6 216 3 aabA Amino-acid-binding protein AabA Dichelobacter nodosus
O84385 5.25e-22 94 25 6 244 1 artJ Probable ABC transporter arginine-binding protein ArtJ Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P45024 2.07e-17 82 27 8 261 1 HI_1080 Probable amino-acid ABC transporter-binding protein HI_1080 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P54952 6.9e-17 80 30 7 221 1 yxeM Probable amino-acid-binding protein YxeM Bacillus subtilis (strain 168)
P42199 2.29e-16 79 28 10 239 1 tcyA L-cystine-binding protein TcyA Bacillus subtilis (strain 168)
Q8ZPA3 2.11e-12 68 21 2 185 1 dalS ABC transporter D-alanine-binding periplasmic protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O34852 1.05e-10 63 23 8 253 1 tcyK L-cystine-binding protein TcyK Bacillus subtilis (strain 168)
P27676 1.84e-10 62 25 4 173 3 glnH Glutamine-binding protein Geobacillus stearothermophilus
Q01269 7.29e-10 61 24 2 157 1 pheC Cyclohexadienyl dehydratase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42400 2.44e-09 59 23 5 231 1 yckB Probable ABC transporter extracellular-binding protein YckB Bacillus subtilis (strain 168)
P52626 2.67e-09 59 24 6 224 3 patH Putative amino-acid ABC transporter-binding protein PatH Vibrio harveyi
Q9ZF60 2.89e-08 56 22 5 228 3 gltI Glutamate/aspartate import solute-binding protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A8ZWR8 3.53e-08 57 22 6 210 3 mltF Membrane-bound lytic murein transglycosylase F Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
O34406 2.29e-07 53 21 5 233 1 tcyJ L-cystine-binding protein TcyJ Bacillus subtilis (strain 168)
Q0P9X8 2.79e-07 53 26 8 209 1 peb1A Major cell-binding factor Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
P37902 4.51e-07 53 22 5 228 1 gltI Glutamate/aspartate import solute-binding protein Escherichia coli (strain K12)
A1VZQ4 1.28e-06 51 25 8 209 3 peb1A Major cell-binding factor Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q8RQL6 2.13e-06 51 22 7 235 3 gluB Glutamate-binding protein GluB Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9I402 2.74e-06 50 28 5 157 1 PA1342 L-glutamate/L-aspartate-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P48242 4.59e-06 50 22 8 266 1 gluB Glutamate-binding protein GluB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q02482 6.37e-05 47 20 4 221 3 Sfri_3689 Putative sensor protein Sfri_3689 Shewanella frigidimarina (strain NCIMB 400)
Q8NQU2 0.000136 45 20 7 238 1 argT Arginine-binding protein ArgT Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P16575 0.000437 45 22 8 235 1 bvgS Virulence sensor protein BvgS Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01205
Feature type CDS
Gene artJ
Product arginine ABC transporter substrate-binding protein
Location 254132 - 254866 (strand: -1)
Length 735 (nucleotides) / 244 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1267
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00497 Bacterial extracellular solute-binding proteins, family 3

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0834 Amino acid transport and metabolism (E)
Signal transduction mechanisms (T)
ET ABC-type amino acid transport/signal transduction system, periplasmic component/domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02030 polar amino acid transport system substrate-binding protein - -

Protein Sequence

MKKLVIAALIGAFAFSAAAAEKQKIRFATEASYAPFETVNEKNEIVGFDVDLAQAMCAKINAECTFTNQAFDSLIPSLKYKRFDALMAGIDVTPERQKQVDFTNTYYDNSAVFVAVAGKFDSIDALKGKQIGIQNGTTHQKYLMEQFKDMKIVPYDSYQNAVLDMKNGRIDAVFGDTAVINEWLKSNDNLKTVGERVTDPEYFGTGLAIAVRKGNSELKDSLNKALGEVKADGTYDTLYKKWFE

Flanking regions ( +/- flanking 50bp)

TGTCACACTGATTTATTTTCTGCCACTGAATAATAAAATGGGATGTTGCTATGAAAAAACTGGTTATTGCTGCATTAATCGGCGCGTTTGCTTTTTCCGCTGCGGCGGCAGAAAAACAAAAAATCCGTTTCGCCACGGAAGCAAGCTATGCACCGTTTGAAACCGTAAATGAAAAAAATGAAATTGTCGGTTTTGATGTGGATCTGGCGCAGGCGATGTGTGCAAAAATCAATGCGGAATGCACATTCACCAACCAGGCATTTGACAGCCTGATCCCGAGCCTGAAATACAAGCGTTTTGATGCGCTGATGGCGGGTATTGATGTCACCCCTGAGCGTCAGAAACAGGTTGATTTCACCAATACTTACTATGATAACTCTGCGGTTTTCGTTGCAGTTGCAGGTAAATTTGATAGCATTGATGCCCTCAAAGGGAAACAGATTGGTATTCAGAACGGCACCACACATCAGAAATACCTGATGGAGCAGTTTAAGGACATGAAAATTGTACCTTATGACAGCTATCAGAATGCCGTACTGGATATGAAAAATGGCCGTATCGATGCCGTCTTCGGTGATACTGCTGTTATTAATGAATGGCTGAAAAGCAACGATAATCTGAAAACTGTGGGTGAGCGCGTCACTGATCCGGAATACTTCGGAACGGGTCTTGCCATTGCTGTCCGTAAAGGCAACAGTGAGCTGAAAGACAGCCTCAACAAGGCACTTGGCGAGGTTAAAGCGGACGGAACGTACGATACCCTCTACAAGAAATGGTTTGAGTAATTACATATAAGAACTAATGGCTGATTTTCTCTCTTTATCAAGTGCCGCCG