Homologs in group_1207

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07010 FBDBKF_07010 81.6 Morganella morganii S1 artQ arginine ABC transporter permease ArtQ
EHELCC_03960 EHELCC_03960 81.6 Morganella morganii S2 artQ arginine ABC transporter permease ArtQ
NLDBIP_03960 NLDBIP_03960 81.6 Morganella morganii S4 artQ arginine ABC transporter permease ArtQ
LHKJJB_09790 LHKJJB_09790 81.6 Morganella morganii S3 artQ arginine ABC transporter permease ArtQ
HKOGLL_09185 HKOGLL_09185 81.6 Morganella morganii S5 artQ arginine ABC transporter permease ArtQ
PMI_RS03345 PMI_RS03345 76.1 Proteus mirabilis HI4320 artQ arginine ABC transporter permease ArtQ

Distribution of the homologs in the orthogroup group_1207

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1207

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE36 1.07e-117 338 71 2 235 3 artQ Arginine ABC transporter permease protein ArtQ Shigella flexneri
P0AE34 1.07e-117 338 71 2 235 1 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli (strain K12)
P0AE35 1.07e-117 338 71 2 235 3 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45090 1.02e-70 218 54 5 235 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52094 1.83e-39 139 37 4 213 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
P0A2I9 5.35e-38 135 35 1 211 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 5.35e-38 135 35 1 211 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
P72295 1.75e-37 134 35 3 220 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
P35118 3.25e-33 123 33 3 228 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A4N5 2.55e-30 115 32 2 219 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 2.55e-30 115 32 2 219 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)
P0AFT4 8.46e-26 103 30 2 224 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 8.46e-26 103 30 2 224 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 8.46e-26 103 30 2 224 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42200 6.73e-24 98 31 5 227 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
P45023 8.55e-24 97 31 3 227 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AEQ9 1.95e-21 91 32 4 223 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 1.95e-21 91 32 4 223 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 1.95e-21 91 32 4 223 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 1.95e-21 91 32 4 223 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
P55660 7.4e-21 90 30 5 231 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P54536 1.68e-20 89 27 2 212 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
O34671 1.97e-20 89 27 3 215 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
P35113 1.09e-19 87 28 2 212 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
Q92J96 1.89e-19 86 27 2 211 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P0A2I7 2.31e-19 86 30 4 218 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 2.31e-19 86 30 4 218 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
Q4UKC4 2.9e-18 83 26 2 211 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P54953 4.42e-18 82 28 2 190 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
P41083 8.33e-18 82 26 1 211 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
Q1RHC0 1.96e-17 81 26 2 211 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
P0AEU6 4.13e-17 80 29 4 220 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 4.13e-17 80 29 4 220 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 4.13e-17 80 29 4 220 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 4.13e-17 80 29 4 220 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
P72296 8.39e-17 80 27 2 220 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
P55661 1.26e-16 79 26 2 202 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q68XN8 2.28e-16 78 25 2 211 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
O34606 6.7e-16 77 25 3 218 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
P52625 1.08e-15 76 26 3 213 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
P35114 1.25e-15 76 30 6 222 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P42399 1.48e-15 76 28 3 217 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
Q8RQL5 1.59e-15 76 30 3 203 3 gluC Glutamate transport system permease protein GluC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P0AE33 1.68e-15 75 28 5 221 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 1.68e-15 75 28 5 221 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 1.68e-15 75 28 5 221 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 1.68e-15 75 28 5 221 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
P0AER5 1.94e-15 75 24 3 217 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 1.94e-15 75 24 3 217 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 1.94e-15 75 24 3 217 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
Q8NQU3 7.06e-15 75 30 7 229 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P45089 7.6e-15 74 34 1 118 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34315 3.92e-14 72 23 4 233 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
P48244 3.3e-13 69 28 3 203 1 gluC Glutamate transport system permease protein GluC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q52813 9.76e-13 70 27 4 197 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P0AER3 1.9e-12 68 25 6 211 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 1.9e-12 68 25 6 211 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O34931 2.59e-11 64 22 1 218 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
P45768 9.78e-11 63 28 8 225 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
Q52665 2.34e-10 63 26 5 219 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q52814 2.62e-10 62 29 4 170 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P45767 3.18e-09 59 27 1 128 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
Q8RQL4 1.9e-07 53 24 5 226 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P48245 9.62e-07 52 23 2 210 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q52664 8.58e-06 49 33 1 111 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS01200
Feature type CDS
Gene artQ
Product arginine ABC transporter permease ArtQ
Location 253411 - 254115 (strand: -1)
Length 705 (nucleotides) / 234 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1207
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4215 Amino acid transport and metabolism (E) E ABC-type arginine transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09999 arginine transport system permease protein ABC transporters -

Protein Sequence

MADFLSLSSAAGITVGLAVSALILGLILAMLFTAWETARLKPLAFIGTCLVTLIRGLPELLVVLFVYYGTLEVIMRLGDGIDLGLFTLQTDIENFDYVPLFSGVIALSLLYASYASQTLRGALKAVPDGQREAGQALGLSRPAIFFRFIMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTKSIATRTQEPFTWYCIVALIYLAITLVSQFILKRIELHTTRFERSAM

Flanking regions ( +/- flanking 50bp)

GTACGATACCCTCTACAAGAAATGGTTTGAGTAATTACATATAAGAACTAATGGCTGATTTTCTCTCTTTATCAAGTGCCGCCGGGATAACCGTCGGCCTTGCTGTTTCTGCGCTCATCCTGGGGCTTATCCTCGCTATGCTGTTTACGGCATGGGAAACTGCGCGCCTGAAACCACTCGCCTTCATTGGCACCTGTCTTGTCACCCTGATCCGTGGTCTTCCTGAACTGCTGGTTGTGCTGTTTGTGTACTACGGCACACTGGAAGTGATAATGCGCCTCGGTGATGGTATTGACCTCGGTTTATTCACTTTACAGACTGACATTGAAAATTTCGATTATGTGCCGCTGTTCAGCGGGGTAATCGCGCTCTCCCTGCTCTATGCCTCTTATGCCTCACAAACACTGCGCGGCGCACTGAAAGCAGTGCCGGACGGGCAGCGGGAAGCAGGACAGGCTCTGGGGCTGAGCCGCCCAGCTATCTTTTTCCGCTTTATTATGCCGCAGATGTGGCGTCATGCGCTGCCGGGGCTGGGAAATCAGTGGCTGGTGCTGCTCAAAGATACCGCGCTGGTGTCACTCATCAGTGTCAATGACCTGATGCTCCAGACAAAAAGTATTGCCACCCGCACCCAGGAGCCCTTTACCTGGTATTGCATCGTGGCGCTGATTTACCTTGCCATTACGCTGGTAAGCCAGTTTATCCTCAAACGCATTGAGCTCCATACCACGCGTTTTGAACGGAGCGCCATGTAATGTTGATGGATTATATTCTCGATATCCTGCCCGGTCTGCCGGTCAGTCTG