Homologs in group_1207

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07010 FBDBKF_07010 72.6 Morganella morganii S1 artQ arginine ABC transporter permease ArtQ
EHELCC_03960 EHELCC_03960 72.6 Morganella morganii S2 artQ arginine ABC transporter permease ArtQ
NLDBIP_03960 NLDBIP_03960 72.6 Morganella morganii S4 artQ arginine ABC transporter permease ArtQ
LHKJJB_09790 LHKJJB_09790 72.6 Morganella morganii S3 artQ arginine ABC transporter permease ArtQ
HKOGLL_09185 HKOGLL_09185 72.6 Morganella morganii S5 artQ arginine ABC transporter permease ArtQ
F4V73_RS01200 F4V73_RS01200 76.1 Morganella psychrotolerans artQ arginine ABC transporter permease ArtQ

Distribution of the homologs in the orthogroup group_1207

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1207

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE36 9.24e-110 318 67 2 238 3 artQ Arginine ABC transporter permease protein ArtQ Shigella flexneri
P0AE34 9.24e-110 318 67 2 238 1 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli (strain K12)
P0AE35 9.24e-110 318 67 2 238 3 artQ Arginine ABC transporter permease protein ArtQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45090 3.21e-68 212 52 4 226 3 artQ Arginine ABC transporter permease protein ArtQ Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P72295 2.69e-41 144 37 2 222 3 occQ Octopine transport system permease protein OccQ Rhizobium meliloti
P52094 1.2e-39 139 36 3 219 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Escherichia coli (strain K12)
P0A2I9 4.58e-37 132 35 3 219 1 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2J0 4.58e-37 132 35 3 219 3 hisQ Histidine/lysine/arginine/ornithine transport system permease protein HisQ Salmonella typhi
P0A4N5 4.45e-36 130 34 1 219 2 occQ Octopine transport system permease protein OccQ Rhizobium radiobacter
P0A4N6 4.45e-36 130 34 1 219 3 occQ Octopine transport system permease protein OccQ Agrobacterium tumefaciens (strain Ach5)
P35118 5.26e-33 122 33 2 226 3 nocQ Nopaline transport system permease protein NocQ Agrobacterium fabrum (strain C58 / ATCC 33970)
P45023 1.51e-26 105 30 3 227 3 HI_1079 Probable amino-acid ABC transporter permease protein HI_0179 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42200 2.09e-26 105 31 3 224 1 tcyB L-cystine transport system permease protein TcyB Bacillus subtilis (strain 168)
P0AFT4 3.48e-26 104 32 2 219 3 tcyL L-cystine transport system permease protein TcyL Shigella flexneri
P0AFT2 3.48e-26 104 32 2 219 1 tcyL L-cystine transport system permease protein TcyL Escherichia coli (strain K12)
P0AFT3 3.48e-26 104 32 2 219 3 tcyL L-cystine transport system permease protein TcyL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P35113 9.05e-25 101 32 4 210 3 nocM Nopaline transport system permease protein NocM Agrobacterium fabrum (strain C58 / ATCC 33970)
Q92J96 6.43e-22 93 26 2 223 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P0AE33 1.09e-21 92 27 4 222 3 artM Arginine ABC transporter permease protein ArtM Shigella flexneri
P0AE30 1.09e-21 92 27 4 222 1 artM Arginine ABC transporter permease protein ArtM Escherichia coli (strain K12)
P0AE31 1.09e-21 92 27 4 222 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE32 1.09e-21 92 27 4 222 3 artM Arginine ABC transporter permease protein ArtM Escherichia coli O157:H7
P0AEQ9 1.6e-21 92 31 3 208 3 glnP Glutamine transport system permease protein GlnP Shigella flexneri
P0AEQ6 1.6e-21 92 31 3 208 1 glnP Glutamine transport system permease protein GlnP Escherichia coli (strain K12)
P0AEQ7 1.6e-21 92 31 3 208 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEQ8 1.6e-21 92 31 3 208 3 glnP Glutamine transport system permease protein GlnP Escherichia coli O157:H7
Q4UKC4 5.28e-21 90 26 2 223 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P41083 7.45e-21 90 25 2 215 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia prowazekii (strain Madrid E)
P72296 1.06e-20 90 27 5 234 3 occM Octopine transport system permease protein OccM Rhizobium meliloti
O34671 1.23e-20 89 26 4 226 2 glnM Probable glutamine ABC transporter permease protein GlnM Bacillus subtilis (strain 168)
Q68XN8 4.44e-20 88 25 2 215 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P55660 5.67e-20 88 35 0 135 3 NGR_a01530 Probable amino-acid ABC transporter permease protein y4tF Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q1RHC0 6.13e-20 87 24 2 223 3 glnP Putative glutamine transport system permease protein GlnP Rickettsia bellii (strain RML369-C)
P54536 1.04e-18 84 26 3 219 1 artQ Arginine transport system permease protein ArtQ Bacillus subtilis (strain 168)
Q8RQL5 6.91e-18 82 27 3 201 3 gluC Glutamate transport system permease protein GluC Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P0A2I7 1.12e-17 82 29 3 217 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2I8 1.12e-17 82 29 3 217 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Salmonella typhi
P35114 1.21e-17 82 28 3 180 2 occM Octopine transport system permease protein OccM Rhizobium radiobacter
P45089 1.65e-17 81 35 1 131 3 artM Arginine ABC transporter permease protein ArtM Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P48244 2.31e-17 81 29 3 201 1 gluC Glutamate transport system permease protein GluC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P52625 2.51e-17 80 26 2 216 3 patM Probable amino-acid ABC transporter permease protein PatM Vibrio harveyi
P54953 3.56e-17 80 27 4 208 1 yxeN Probable amino-acid permease protein YxeN Bacillus subtilis (strain 168)
P0AEU6 4.92e-17 80 29 3 217 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Shigella flexneri
P0AEU3 4.92e-17 80 29 3 217 1 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli (strain K12)
P0AEU4 4.92e-17 80 29 3 217 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEU5 4.92e-17 80 29 3 217 3 hisM Histidine/lysine/arginine/ornithine transport system permease protein HisM Escherichia coli O157:H7
Q8NQU3 5.32e-16 79 32 7 229 1 argU Arginine transport system permease protein ArgU Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P55661 8.1e-16 77 23 2 217 3 NGR_a01520 Probable amino-acid ABC transporter permease protein y4tG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P42399 9.33e-16 76 27 3 216 3 yckA Probable amino-acid ABC transporter permease protein YckA Bacillus subtilis (strain 168)
P0AER5 6.88e-15 74 24 2 218 1 gltK Glutamate/aspartate import permease protein GltK Escherichia coli (strain K12)
P0AER6 6.88e-15 74 24 2 218 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AER7 6.88e-15 74 24 2 218 3 gltK Glutamate/aspartate import permease protein GltK Escherichia coli O157:H7
O34315 1.49e-14 73 25 4 210 1 tcyL L-cystine transport system permease protein TcyL Bacillus subtilis (strain 168)
Q52813 7.29e-14 73 27 3 186 3 aapQ General L-amino acid transport system permease protein AapQ Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O34606 3.09e-13 69 23 3 220 2 glnP Probable glutamine ABC transporter permease protein GlnP Bacillus subtilis (strain 168)
Q52665 5.52e-11 65 31 2 135 3 bztC Glutamate/glutamine/aspartate/asparagine transport system permease protein BztC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0AER3 2e-10 62 25 6 210 1 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli (strain K12)
P0AER4 2e-10 62 25 6 210 3 gltJ Glutamate/aspartate import permease protein GltJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q52814 5.94e-10 62 26 4 180 3 aapM General L-amino acid transport system permease protein AapM Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P45768 1.41e-09 60 32 4 129 1 yhdY Inner membrane amino-acid ABC transporter permease protein YhdY Escherichia coli (strain K12)
P45767 1.97e-09 60 27 1 128 3 yhdX Putative amino-acid ABC transporter permease protein YhdX Escherichia coli (strain K12)
O34931 3.65e-09 58 23 5 219 1 tcyM L-cystine transport system permease protein TcyM Bacillus subtilis (strain 168)
Q52664 5.83e-07 53 29 2 157 3 bztB Glutamate/glutamine/aspartate/asparagine transport system permease protein BztB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8RQL4 2.37e-06 50 23 7 226 3 gluD Glutamate transport system permease protein GluD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P48245 3.48e-06 50 31 2 109 1 gluD Glutamate transport system permease protein GluD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03345
Feature type CDS
Gene artQ
Product arginine ABC transporter permease ArtQ
Location 738227 - 738931 (strand: -1)
Length 705 (nucleotides) / 234 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1207
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4215 Amino acid transport and metabolism (E) E ABC-type arginine transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09999 arginine transport system permease protein ABC transporters -

Protein Sequence

MNEITTLAGATVTTVTLAISALIIGLVLAMLFTAWESAKWKAFAFLGTCWVTLIRGLPEMLVVLFVYYGTLQGVMMLMDGIELGPFTLQFDFGDTESLPFYCGVIALSLLYASYASQTLRGALKAVPTGQWEAGQALGMGKITIFFRFIMPQMWRHALPGLGNQWLVLLKDTALVSLISVNDLMLQTQSIANRTQEPFTWYSIVALIYLAITLVSQYILKWLEMRTTRFERSAS

Flanking regions ( +/- flanking 50bp)

ATAAAAAATGGTTTGAATAATTATAGTTAATAACAACAATAGCTTAATAAATGAATGAAATAACAACGCTAGCAGGTGCGACCGTGACTACGGTCACACTTGCTATTTCTGCTCTTATTATCGGATTAGTTCTAGCCATGCTGTTTACTGCGTGGGAATCCGCAAAGTGGAAAGCCTTTGCTTTTCTAGGAACTTGCTGGGTAACACTAATTAGAGGACTGCCAGAAATGCTGGTGGTTCTTTTTGTCTATTATGGCACCTTACAAGGTGTCATGATGCTCATGGATGGTATTGAATTAGGCCCTTTCACCTTACAATTTGACTTTGGTGATACTGAATCTTTACCTTTCTATTGTGGTGTTATCGCCCTTTCACTTCTGTATGCGTCTTACGCTTCACAAACTTTACGTGGTGCATTAAAAGCCGTGCCAACCGGACAGTGGGAAGCAGGACAGGCATTGGGTATGGGAAAAATCACCATTTTTTTCCGCTTTATCATGCCCCAAATGTGGCGTCACGCGTTACCCGGACTCGGTAATCAGTGGTTAGTGCTCTTAAAAGATACCGCTTTAGTCTCATTAATTAGCGTTAATGATTTAATGCTACAAACCCAGAGTATTGCCAATCGTACTCAAGAGCCTTTTACTTGGTATAGCATTGTGGCACTTATCTATTTAGCCATTACATTAGTCAGCCAATATATTCTGAAATGGTTAGAGATGAGAACGACCCGATTTGAACGGAGTGCCTCATAATGTGGGATTATATTGTTGATATTTTACCAGGCTTACCGACCAGTTTATCA