Homologs in group_1547

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09680 FBDBKF_09680 78.1 Morganella morganii S1 modF molybdate ABC transporter ATP-binding protein ModF
EHELCC_04480 EHELCC_04480 78.1 Morganella morganii S2 modF molybdate ABC transporter ATP-binding protein ModF
NLDBIP_04480 NLDBIP_04480 78.1 Morganella morganii S4 modF molybdate ABC transporter ATP-binding protein ModF
LHKJJB_14150 LHKJJB_14150 78.1 Morganella morganii S3 modF molybdate ABC transporter ATP-binding protein ModF
HKOGLL_12385 HKOGLL_12385 78.1 Morganella morganii S5 modF molybdate ABC transporter ATP-binding protein ModF
PMI_RS02915 PMI_RS02915 60.9 Proteus mirabilis HI4320 modF molybdate ABC transporter ATP-binding protein ModF

Distribution of the homologs in the orthogroup group_1547

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1547

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P31060 0.0 623 61 3 489 2 modF ABC transporter ATP-binding protein ModF Escherichia coli (strain K12)
Q9UT95 6.3e-51 183 28 12 466 3 SPAC323.04 Uncharacterized ABC transporter ATP-binding protein C323.04 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9UT95 9.98e-08 58 23 4 206 3 SPAC323.04 Uncharacterized ABC transporter ATP-binding protein C323.04 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9UT95 8.75e-07 55 25 6 173 3 SPAC323.04 Uncharacterized ABC transporter ATP-binding protein C323.04 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q12298 5.67e-36 143 27 11 381 1 YDR061W Uncharacterized ABC transporter ATP-binding protein YDR061W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q02151 1.36e-26 111 33 3 202 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
Q02151 8.1e-10 63 25 6 232 3 ymeB Uncharacterized ABC transporter ATP-binding protein YmeB Lactococcus lactis subsp. lactis (strain IL1403)
O31723 5.62e-26 109 32 3 212 2 ylmA Uncharacterized ABC transporter ATP-binding protein YlmA Bacillus subtilis (strain 168)
O31723 1.71e-07 56 28 1 114 2 ylmA Uncharacterized ABC transporter ATP-binding protein YlmA Bacillus subtilis (strain 168)
O34338 3.44e-24 104 30 5 232 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
O34338 4.75e-07 54 23 4 188 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
Q97SA3 2.37e-23 106 24 16 494 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 3.83e-05 50 24 3 196 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q65E55 9.48e-23 104 25 18 483 3 rbsA Ribose import ATP-binding protein RbsA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q87G35 1.39e-22 104 26 16 488 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 4.69e-07 55 24 6 225 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 2.35e-06 53 24 5 202 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D3Z9 7.23e-22 102 26 18 494 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 2.24e-06 53 24 6 202 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 3.12e-06 53 23 6 223 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q7MFH3 5.62e-21 99 26 18 494 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 3.34e-06 53 24 6 201 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 9.4e-06 52 23 6 223 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q92AF9 9.27e-21 94 31 4 194 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q92AF9 6.36e-06 51 24 6 205 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DQY5 1.08e-20 98 24 16 498 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 2.15e-06 53 24 3 207 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q88ZZ2 6.36e-20 96 25 18 501 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 4.62e-11 68 29 7 204 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P96117 6.93e-20 92 31 3 200 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
P96117 5.87e-16 81 29 4 202 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
Q8Y651 1.35e-19 91 30 4 194 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8Y651 8.51e-08 56 22 4 196 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P72477 1.48e-19 91 28 4 209 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P72477 7.04e-07 54 22 5 215 3 abcX Putative ABC transporter ATP-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8DY60 3.54e-19 94 24 14 480 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E3S6 8.41e-19 92 24 14 480 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8ES39 2.27e-18 91 25 21 492 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 8.73e-08 58 24 6 195 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q93D97 2.8e-18 91 24 18 492 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 1.66e-05 51 24 4 200 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q21PQ7 7.02e-18 86 30 5 219 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q21PQ7 8.44e-09 60 27 2 152 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q87RE5 2.99e-17 85 31 3 199 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87RE5 3.34e-10 64 27 3 159 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q74I62 3.41e-17 87 24 17 522 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 1.9e-06 53 22 6 220 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9KD30 5.52e-17 84 27 3 194 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KD30 1.61e-06 52 22 6 226 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0A9U3 8.26e-17 86 22 18 518 1 ybiT Probable ATP-binding protein YbiT Escherichia coli (strain K12)
P0A9U4 8.26e-17 86 22 18 518 1 ybiT Probable ATP-binding protein YbiT Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9U5 8.26e-17 86 22 18 518 3 ybiT Probable ATP-binding protein YbiT Escherichia coli O157:H7
P77509 1.34e-16 85 23 16 478 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
P77509 1.61e-05 50 27 11 226 3 yphE Uncharacterized ABC transporter ATP-binding protein YphE Escherichia coli (strain K12)
Q89AJ0 1.83e-16 82 25 3 217 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q89AJ0 1.25e-07 56 28 5 169 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q5HCL3 1.93e-16 85 25 19 486 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
A1WXT0 2.25e-16 82 29 6 214 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
A1WXT0 9.52e-07 53 28 4 159 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q6LTB1 2.29e-16 82 30 3 193 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q6LTB1 2.15e-09 61 29 4 164 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q99QV7 2.37e-16 85 25 19 486 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 2.37e-16 85 25 19 486 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q8REE1 2.69e-16 84 21 12 462 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8REE1 0.000185 47 25 0 100 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q6LQ00 3.75e-16 84 25 12 367 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 1.67e-07 57 27 8 221 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 0.000741 45 23 5 203 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q8NUH8 3.93e-16 84 25 19 486 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 3.93e-16 84 25 19 486 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6BEX0 6.88e-16 83 24 14 451 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
Q6BEX0 4.41e-05 49 29 1 92 1 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli (strain K12)
P63299 7.52e-16 83 24 14 451 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
P63299 4.52e-05 49 29 1 92 3 ytfR Galactofuranose transporter ATP-binding protein YtfR Escherichia coli O157:H7
Q9XDA6 7.64e-16 80 30 9 241 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9XDA6 8.57e-06 50 26 6 188 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2RGX2 7.9e-16 83 23 15 475 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2RGX2 3.5e-06 53 28 0 87 3 xylG Xylose import ATP-binding protein XylG Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q926D8 1.02e-15 80 30 9 241 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q926D8 1.2e-06 53 25 4 176 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q66AT7 1.16e-15 80 30 7 224 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q66AT7 4.49e-09 60 29 5 171 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CJG3 1.3e-15 80 30 7 224 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CJG3 4.79e-09 60 29 5 171 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 1.3e-15 80 30 7 224 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q7CIC2 4.79e-09 60 29 5 171 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 1.3e-15 80 30 7 224 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C812 4.79e-09 60 29 5 171 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q57399 1.51e-15 79 27 3 215 1 molC Molybdate import ATP-binding protein MolC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q891M1 2.53e-15 82 21 12 465 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q891M1 3.69e-05 50 21 4 202 3 rbsA Ribose import ATP-binding protein RbsA Clostridium tetani (strain Massachusetts / E88)
Q6GDC0 2.57e-15 82 24 19 492 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q7MMN0 2.61e-15 79 29 3 201 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q7MMN0 1.95e-08 58 27 2 159 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 2.61e-15 79 29 3 201 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q8DFQ4 1.95e-08 58 27 2 159 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q6DB87 3.1e-15 81 25 7 328 3 rbsA Ribose import ATP-binding protein RbsA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6DB87 1.19e-05 51 27 0 87 3 rbsA Ribose import ATP-binding protein RbsA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6DB87 0.000696 45 24 3 194 3 rbsA Ribose import ATP-binding protein RbsA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q73R11 3.76e-15 81 24 13 444 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q1R528 5.15e-15 80 23 13 493 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q1R528 0.000158 47 25 1 101 3 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain UTI89 / UPEC)
Q83J33 5.29e-15 80 23 13 493 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q83J33 0.000169 47 27 0 79 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri
Q832R5 5.89e-15 80 24 20 514 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 1.94e-05 50 22 6 211 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 0.000699 45 32 0 78 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8Y003 7.25e-15 80 21 12 480 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8Y003 2.71e-05 50 23 5 195 3 RSc1242 Putative ribose/galactose/methyl galactoside import ATP-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q81HW8 8.67e-15 80 22 14 457 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81HW8 5.5e-09 62 27 7 200 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8FCE2 1.19e-14 79 23 10 484 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FCE2 0.000181 47 27 0 79 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBN5 1.19e-14 79 23 10 484 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TBN5 0.000181 47 27 0 79 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0SY86 1.51e-14 79 23 13 493 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
Q0SY86 0.000175 47 27 0 79 3 xylG Xylose import ATP-binding protein XylG Shigella flexneri serotype 5b (strain 8401)
P32721 1.6e-14 79 21 13 487 3 alsA D-allose import ATP-binding protein AlsA Escherichia coli (strain K12)
P32721 0.000575 46 23 0 88 3 alsA D-allose import ATP-binding protein AlsA Escherichia coli (strain K12)
Q3IWB5 1.64e-14 76 30 5 213 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q3IWB5 2.33e-09 61 28 5 183 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9HT73 1.88e-14 77 29 6 225 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HT73 2.74e-10 64 30 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK9 1.88e-14 77 29 6 225 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q02DK9 2.74e-10 64 30 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6VMN4 1.88e-14 79 22 15 480 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q6VMN4 3.83e-06 53 24 0 102 3 xylG Xylose import ATP-binding protein XylG Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q5WC31 1.95e-14 79 24 14 429 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
Q5WC31 2.4e-07 57 23 4 201 3 rbsA Ribose import ATP-binding protein RbsA Shouchella clausii (strain KSM-K16)
O52618 2.04e-14 77 31 6 205 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
O52618 2.33e-08 59 27 6 205 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
Q6YRJ4 2.1e-14 79 23 17 499 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 9.3e-10 64 23 3 196 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q31V51 2.26e-14 79 23 13 493 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q31V51 0.000172 47 25 1 101 3 xylG Xylose import ATP-binding protein XylG Shigella boydii serotype 4 (strain Sb227)
Q8XDM1 2.26e-14 79 23 13 493 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q8XDM1 0.000172 47 25 1 101 3 xylG Xylose import ATP-binding protein XylG Escherichia coli O157:H7
Q8RD43 2.4e-14 79 24 15 462 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD43 0.000174 47 27 0 79 3 rbsA Ribose import ATP-binding protein RbsA Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8XK20 2.76e-14 79 24 12 365 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 4.68e-07 55 23 6 221 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q5E6M2 3.15e-14 75 29 4 194 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E6M2 9.49e-06 50 24 2 159 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8U9B0 3.27e-14 78 22 13 479 3 Atu3818 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8U9B0 1.05e-05 51 23 0 97 3 Atu3818 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1BX03 3.31e-14 78 21 14 484 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
Q1BX03 1.62e-05 51 22 6 206 3 Bcen_0943 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia orbicola (strain AU 1054)
A0K6Q0 3.31e-14 78 21 14 484 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
A0K6Q0 1.62e-05 51 22 6 206 3 Bcen2424_1425 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Burkholderia cenocepacia (strain HI2424)
Q48PV0 3.84e-14 75 26 6 235 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48PV0 9.34e-08 57 28 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q63FX9 3.85e-14 78 22 12 448 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q63FX9 9.37e-10 64 26 7 209 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ZK / E33L)
Q6HNE7 3.89e-14 78 23 13 450 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HNE7 8.96e-10 64 26 7 209 3 rbsA Ribose import ATP-binding protein RbsA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81V36 3.89e-14 78 23 13 450 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q81V36 8.96e-10 64 26 7 209 3 rbsA Ribose import ATP-binding protein RbsA Bacillus anthracis
Q0ST95 3.9e-14 78 21 14 465 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q0ST95 0.000267 47 22 2 132 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain SM101 / Type A)
Q1J3P2 4.87e-14 77 23 13 475 3 rbsA Ribose import ATP-binding protein RbsA Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q1J3P2 0.00022 47 33 1 77 3 rbsA Ribose import ATP-binding protein RbsA Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
P94440 4.94e-14 76 29 5 202 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
P94440 2.12e-06 53 23 3 203 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
P37388 5.02e-14 77 23 13 493 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
P37388 0.000175 47 25 1 101 1 xylG Xylose import ATP-binding protein XylG Escherichia coli (strain K12)
Q4ZRC6 5.22e-14 77 24 14 466 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q4ZRC6 9.61e-06 51 26 0 102 3 Psyr_3264 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. syringae (strain B728a)
Q81PZ8 5.58e-14 77 25 13 364 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 4.16e-11 68 24 4 197 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q2PBM0 6.08e-14 77 22 14 461 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q2PBM0 0.000436 46 30 0 70 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus luminescens
Q57554 6.86e-14 75 32 6 193 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57554 8.84e-06 50 21 4 181 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q73DH7 6.94e-14 77 22 12 448 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q73DH7 3.96e-09 62 26 7 209 3 rbsA Ribose import ATP-binding protein RbsA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q92TS8 7.1e-14 77 22 18 474 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q92TS8 2.63e-06 53 25 9 215 3 RB1420 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Rhizobium meliloti (strain 1021)
Q9KAG5 7.26e-14 77 21 13 469 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KAG5 3.13e-05 50 21 4 214 3 BH2322 Putative ribose/galactose/methyl galactoside import ATP-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q87UN0 7.72e-14 75 27 5 223 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87UN0 3.76e-08 58 28 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q0BG60 7.76e-14 77 21 13 480 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0BG60 8.5e-06 52 23 7 215 3 Bamb_1305 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1IGY7 8.58e-14 74 28 7 215 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q1IGY7 2.62e-09 61 29 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
P42360 8.78e-14 74 28 3 172 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
P42360 7.06e-06 50 26 6 187 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q4ZZS2 9.32e-14 74 27 6 224 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q4ZZS2 2.37e-08 58 28 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
P33916 9.37e-14 77 23 16 472 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
P33916 1.56e-05 51 22 6 202 1 yejF Uncharacterized ABC transporter ATP-binding protein YejF Escherichia coli (strain K12)
Q81J16 9.6e-14 75 29 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q88RL1 9.88e-14 74 27 7 224 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q88RL1 3.39e-09 61 28 4 169 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q73F67 1.02e-13 75 29 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8XKQ2 1.05e-13 77 21 15 481 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q8XKQ2 6.13e-05 49 23 1 117 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain 13 / Type A)
Q50294 1.21e-13 74 27 6 197 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8D7T7 1.23e-13 76 22 12 461 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q8D7T7 0.000128 48 31 1 67 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain CMCP6)
Q0TQU8 1.25e-13 76 21 14 465 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TQU8 1.67e-05 50 23 2 132 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6LH11 1.45e-13 76 22 13 475 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q6LH11 4.13e-05 49 25 1 108 3 rbsA Ribose import ATP-binding protein RbsA Photobacterium profundum (strain SS9)
Q4KKK4 1.46e-13 73 28 7 215 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KKK4 5.35e-11 66 32 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A0LCH8 1.64e-13 73 27 5 212 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A0LCH8 1.04e-06 53 24 4 175 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q737I0 1.67e-13 76 23 19 489 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 2.47e-07 57 22 4 197 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
P36947 1.81e-13 75 22 13 460 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
P36947 1.91e-09 63 24 10 211 3 rbsA Ribose import ATP-binding protein RbsA Bacillus subtilis (strain 168)
Q9K6J9 1.82e-13 75 24 13 424 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K6J9 2.52e-06 53 28 0 84 3 rbsA Ribose import ATP-binding protein RbsA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1JRI2 1.82e-13 73 29 8 225 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1JRI2 1.02e-08 59 29 5 172 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P47425 1.87e-13 73 29 11 207 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P47425 1.44e-05 50 25 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q31I51 2.03e-13 73 27 6 218 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q31I51 1.02e-07 56 28 2 154 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1CDJ0 2.03e-13 75 24 14 457 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDJ0 0.000848 45 24 9 205 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CG00 2.03e-13 75 24 14 457 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q7CG00 0.000848 45 24 9 205 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis
Q1C1B8 2.03e-13 75 24 14 457 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1B8 0.000848 45 24 9 205 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pestis bv. Antiqua (strain Antiqua)
Q6HPN0 2.06e-13 73 28 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 2.06e-13 73 28 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 2.06e-13 73 28 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q6HI76 2.32e-13 75 25 13 364 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 5.32e-11 68 24 4 197 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63TX3 2.49e-13 73 30 6 215 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q63TX3 3.24e-05 49 47 0 55 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q3JSQ0 2.63e-13 73 30 6 215 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q3JSQ0 3.18e-05 49 47 0 55 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 2.63e-13 73 30 6 215 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q62K72 3.18e-05 49 47 0 55 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q63H62 2.65e-13 73 28 6 192 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q39HA1 2.68e-13 75 21 14 487 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39HA1 1.53e-05 51 23 7 215 3 Bcep18194_A4569 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4W575 2.71e-13 74 29 6 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 2.71e-13 74 29 6 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8A883 3.02e-13 75 30 6 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8G838 3.05e-13 75 24 22 513 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q664G2 3.14e-13 75 24 14 457 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q664G2 0.000878 45 24 9 205 3 rbsA Ribose import ATP-binding protein RbsA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q57HW1 3.26e-13 75 24 15 483 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q57HW1 7.51e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q57HW1 0.000135 48 26 4 186 3 rbsA Ribose import ATP-binding protein RbsA Salmonella choleraesuis (strain SC-B67)
Q7MEV1 3.32e-13 75 22 13 462 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q7MEV1 0.000122 48 30 0 63 3 rbsA Ribose import ATP-binding protein RbsA Vibrio vulnificus (strain YJ016)
Q5WBL0 3.66e-13 72 30 4 202 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q5WBL0 0.00021 46 26 6 171 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q5FA19 4.01e-13 73 30 7 205 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1M7W6 4.5e-13 73 30 5 203 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1M7W6 4.89e-07 55 26 6 203 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8U949 4.75e-13 74 24 14 447 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8U949 1.92e-05 50 27 12 235 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8U949 8.16e-05 48 26 7 191 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q02XM9 4.96e-13 74 21 16 461 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q02XM9 0.000289 47 33 1 74 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. cremoris (strain SK11)
Q5E4V6 5.25e-13 74 23 14 472 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q5E4V6 9.36e-05 48 26 0 92 3 rbsA Ribose import ATP-binding protein RbsA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q56342 5.38e-13 74 23 14 458 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q56342 8.01e-06 52 30 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Treponema pallidum (strain Nichols)
Q8ZKV9 5.7e-13 74 23 16 489 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZKV9 6.59e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZKV9 0.000191 47 26 4 186 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57243 5.72e-13 72 28 5 199 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37624 5.83e-13 75 22 11 352 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
P37624 1.14e-06 55 27 4 168 1 rbbA Ribosome-associated ATPase Escherichia coli (strain K12)
Q92XW1 5.93e-13 73 30 6 206 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q8RD07 6.56e-13 72 26 8 214 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8RD07 8.3e-06 50 28 4 178 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q032H3 7.55e-13 72 25 7 268 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q032H3 1.36e-07 56 26 5 198 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q3YVK8 7.77e-13 73 22 12 480 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
Q3YVK8 7.57e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
Q3YVK8 0.000277 47 26 5 192 3 rbsA Ribose import ATP-binding protein RbsA Shigella sonnei (strain Ss046)
P04983 7.84e-13 73 23 13 485 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
P04983 8.33e-05 48 27 1 102 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
P04983 0.000292 47 26 5 192 1 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain K12)
Q0TAW0 7.84e-13 73 23 13 485 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TAW0 8.33e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TAW0 0.000292 47 26 5 192 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A2RI02 8.44e-13 72 25 7 268 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
A2RI02 1.48e-07 56 26 5 193 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q6D4A8 8.68e-13 71 28 6 223 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D4A8 2.01e-10 64 30 3 170 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0K9I2 9.08e-13 72 32 6 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0K9I2 5.82e-06 51 26 7 225 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8DMY0 9.66e-13 72 30 7 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DMY0 2.12e-07 55 27 7 201 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 9.66e-13 72 30 7 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q04HV8 2.12e-07 55 27 7 201 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2SVP3 1.02e-12 72 29 6 214 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SVP3 6.51e-05 48 47 0 55 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q3KKA1 1.08e-12 71 28 7 216 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q3KKA1 6.56e-11 66 32 4 159 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q9CF44 1.09e-12 73 21 15 461 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. lactis (strain IL1403)
Q9CF44 7.5e-05 48 24 7 225 3 rbsA Ribose import ATP-binding protein RbsA Lactococcus lactis subsp. lactis (strain IL1403)
Q0I4A9 1.13e-12 71 29 3 192 3 znuC Zinc import ATP-binding protein ZnuC Histophilus somni (strain 129Pt)
Q0I4A9 0.000859 44 24 3 159 3 znuC Zinc import ATP-binding protein ZnuC Histophilus somni (strain 129Pt)
Q2SPI3 1.17e-12 71 27 5 213 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q2SPI3 3.05e-05 49 28 5 150 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q02QM1 1.22e-12 71 31 9 213 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9WXX8 1.25e-12 70 25 4 212 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9WXX8 2.59e-07 55 27 5 173 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q97N51 1.36e-12 71 30 7 224 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97N51 6.42e-08 57 28 7 201 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q1R4I3 1.37e-12 73 23 13 485 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
Q1R4I3 8.05e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
Q1R4I3 0.000307 47 26 5 192 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli (strain UTI89 / UPEC)
Q92UI2 1.56e-12 73 23 10 453 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium meliloti (strain 1021)
Q9HYL7 1.59e-12 71 31 9 213 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KN37 1.63e-12 73 22 13 464 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KN37 8.32e-05 48 26 0 92 3 rbsA Ribose import ATP-binding protein RbsA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8FBS3 1.64e-12 73 23 13 485 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FBS3 8.7e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8Z2R4 1.65e-12 73 23 16 489 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q8Z2R4 6.53e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q8Z2R4 0.000197 47 26 4 186 3 rbsA Ribose import ATP-binding protein RbsA Salmonella typhi
Q60AB3 1.83e-12 69 27 5 198 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q8XAW7 1.87e-12 72 23 13 485 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q8XAW7 7.77e-05 48 27 1 102 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q8XAW7 0.000302 47 26 5 192 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Escherichia coli O157:H7
Q73P93 1.89e-12 72 22 16 465 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q897I2 2.02e-12 72 23 14 352 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 2.15e-09 63 23 7 244 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P44884 2.05e-12 72 21 11 452 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44884 7.16e-05 48 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QM77 2.05e-12 72 21 11 452 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q4QM77 7.16e-05 48 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Haemophilus influenzae (strain 86-028NP)
Q81N53 2.07e-12 72 23 15 496 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q1LNM0 2.09e-12 71 31 6 206 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LNM0 1.1e-07 57 26 5 223 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9CP98 2.16e-12 72 23 14 481 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q9CP98 7.82e-06 52 20 4 227 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Pasteurella multocida (strain Pm70)
Q92W60 2.33e-12 72 24 13 430 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium meliloti (strain 1021)
Q8X5I6 2.4e-12 70 29 6 203 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
Q8X5I6 0.000214 46 27 6 180 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O157:H7
P72335 2.53e-12 71 28 7 204 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
P72335 6.39e-07 54 28 8 217 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q1GHE5 2.54e-12 72 23 11 468 3 rbsA Ribose import ATP-binding protein RbsA Ruegeria sp. (strain TM1040)
Q1GHE5 1.67e-06 54 28 5 201 3 rbsA Ribose import ATP-binding protein RbsA Ruegeria sp. (strain TM1040)
Q1GHE5 0.001 45 26 0 104 3 rbsA Ribose import ATP-binding protein RbsA Ruegeria sp. (strain TM1040)
Q8ENB3 2.73e-12 72 21 16 480 3 rbsA Ribose import ATP-binding protein RbsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ENB3 4.25e-08 59 22 4 213 3 rbsA Ribose import ATP-binding protein RbsA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q07756 3.17e-12 70 32 6 192 3 nodI Nod factor export ATP-binding protein I Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8GNH6 3.34e-12 71 30 7 218 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q8GNH6 3.31e-08 58 26 6 205 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q32HA3 3.43e-12 69 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q32HA3 2.49e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q6HG98 3.45e-12 72 24 15 489 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HG98 0.000103 48 27 6 188 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
P33982 3.74e-12 70 27 6 212 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A2RKA7 3.74e-12 72 24 12 433 1 nupA Nucleoside import ATP-binding protein NupA Lactococcus lactis subsp. cremoris (strain MG1363)
A1B9K8 3.75e-12 69 29 6 213 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
A1B9K8 1.35e-08 59 28 4 160 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
Q48GY7 4.6e-12 71 23 15 466 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48GY7 2.93e-05 50 33 0 71 3 PSPPH_3184 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q50966 4.64e-12 70 29 7 208 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q8G847 4.78e-12 71 22 14 479 1 fruK Fructose import ATP-binding protein FruK Bifidobacterium longum (strain NCC 2705)
Q8G847 3.89e-10 65 29 5 200 1 fruK Fructose import ATP-binding protein FruK Bifidobacterium longum (strain NCC 2705)
P08720 4.79e-12 70 30 5 203 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
P08720 9.61e-07 54 26 6 203 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
Q7N2D9 4.93e-12 71 25 12 363 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N2D9 0.000383 46 30 0 70 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0S9A4 4.93e-12 71 23 16 464 3 rbsA Ribose import ATP-binding protein RbsA Rhodococcus jostii (strain RHA1)
Q0S9A4 5.4e-05 49 24 1 107 3 rbsA Ribose import ATP-binding protein RbsA Rhodococcus jostii (strain RHA1)
Q972J5 5.15e-12 71 24 21 501 3 STK_11360 Putative ABC transporter ATP-binding protein STK_11360 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O93796 5.19e-12 72 25 7 293 3 TEF3 Elongation factor 3 Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q5PJX5 5.5e-12 71 23 14 482 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PJX5 7.98e-05 48 27 1 102 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PJX5 0.000766 45 26 5 188 3 rbsA Ribose import ATP-binding protein RbsA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1M360 6.17e-12 71 22 12 432 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P25885 6.58e-12 69 27 5 212 3 R00382 Uncharacterized ABC transporter ATP-binding protein R00382 Rhizobium meliloti (strain 1021)
Q1GL85 6.68e-12 68 29 5 215 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
Q1GL85 9.88e-11 65 29 5 173 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
Q9CIS8 6.79e-12 69 24 7 286 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9CIS8 1.15e-06 53 26 5 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
P48334 7.94e-12 68 26 3 199 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
P48334 2.43e-08 58 25 3 172 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
Q3K3R2 8.09e-12 70 22 19 476 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K3R2 2.39e-06 53 23 3 195 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q7N545 8.1e-12 68 27 7 224 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7N545 1.3e-08 59 29 4 161 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8Z5W6 8.52e-12 68 27 5 203 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q8Z5W6 2.07e-06 52 28 4 174 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q882S0 9.02e-12 68 29 8 209 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3Z542 9.33e-12 68 29 6 203 3 tauB Taurine import ATP-binding protein TauB Shigella sonnei (strain Ss046)
Q3Z542 0.000155 47 26 6 189 3 tauB Taurine import ATP-binding protein TauB Shigella sonnei (strain Ss046)
Q47538 9.33e-12 68 29 6 203 2 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain K12)
Q47538 0.000155 47 26 6 189 2 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain K12)
Q28VN1 9.36e-12 68 27 5 212 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
Q28VN1 9.13e-08 56 26 6 183 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
Q3Z2L6 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q3Z2L6 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q322E8 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
Q1RAS6 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 9.44e-12 68 29 5 206 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X1 1.6e-07 55 29 5 174 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9X2 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TGX4 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
A1AC19 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 9.44e-12 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
P0A9X3 1.6e-07 55 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q045Z8 9.52e-12 68 27 8 209 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q0A9E2 1.13e-11 68 29 6 215 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0A9E2 6.85e-07 54 30 3 162 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
O34392 1.16e-11 67 30 7 198 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q81CT8 1.19e-11 70 23 20 497 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 1.2e-08 61 25 6 200 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1BWI2 1.23e-11 68 28 6 202 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q1BWI2 5.54e-05 48 45 0 55 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q325N3 1.33e-11 68 29 6 203 3 tauB Taurine import ATP-binding protein TauB Shigella boydii serotype 4 (strain Sb227)
Q325N3 0.000169 47 26 6 189 3 tauB Taurine import ATP-binding protein TauB Shigella boydii serotype 4 (strain Sb227)
Q825P1 1.37e-11 70 23 13 449 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q825P1 0.000377 46 32 1 70 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q83KR7 1.48e-11 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q83KR7 3.99e-07 54 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 1.48e-11 68 29 5 206 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q0T3U8 3.99e-07 54 29 5 174 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q32IZ6 1.5e-11 68 29 5 203 3 tauB Taurine import ATP-binding protein TauB Shigella dysenteriae serotype 1 (strain Sd197)
Q32IZ6 0.00013 47 26 4 182 3 tauB Taurine import ATP-binding protein TauB Shigella dysenteriae serotype 1 (strain Sd197)
Q830W6 1.54e-11 69 26 6 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q830W6 9.85e-05 48 26 4 177 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q03PF2 1.59e-11 69 28 6 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5PIA5 1.61e-11 67 27 4 199 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PIA5 1.66e-07 55 29 4 174 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 1.61e-11 67 27 4 199 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q57NA5 1.66e-07 55 29 4 174 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q9KQB8 1.68e-11 68 29 4 194 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KQB8 4.65e-07 54 27 2 158 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q669P3 1.68e-11 67 29 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9CP24 1.7e-11 68 31 4 178 3 znuC Zinc import ATP-binding protein ZnuC Pasteurella multocida (strain Pm70)
P0C0E2 1.72e-11 67 24 4 226 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes
P0C0E2 1.45e-06 52 27 5 195 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes
P0C0E3 1.72e-11 67 24 4 226 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes serotype M1
P0C0E3 1.45e-06 52 27 5 195 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes serotype M1
P55476 1.76e-11 68 29 7 224 3 nodI Nod factor export ATP-binding protein I Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55476 0.000661 45 45 0 55 3 nodI Nod factor export ATP-binding protein I Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q83MA0 1.86e-11 67 29 5 203 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri
Q83MA0 0.000177 47 26 6 189 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri
Q87H79 1.9e-11 69 21 10 457 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87H79 0.00017 47 30 0 63 3 rbsA Ribose import ATP-binding protein RbsA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P26050 1.99e-11 68 29 6 207 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P26050 3.52e-08 58 28 7 215 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8ZNV7 2.05e-11 67 27 4 199 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZNV7 1.86e-07 55 29 4 174 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q92VJ2 2.13e-11 68 29 6 200 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q1CI46 2.33e-11 67 29 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 2.33e-11 67 29 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 2.33e-11 67 29 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q8PUE7 2.35e-11 69 24 10 336 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 9.13e-07 55 23 3 218 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 6.4e-05 49 25 8 204 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q4L885 2.35e-11 67 27 5 185 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q6RCE0 2.43e-11 67 30 8 211 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q03ZQ0 2.71e-11 68 28 8 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q03ZQ0 4.74e-05 49 25 5 174 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P0A9V4 2.86e-11 67 27 7 222 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V4 0.000323 45 26 0 91 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Shigella flexneri
P0A9V1 2.86e-11 67 27 7 222 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V1 0.000323 45 26 0 91 1 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli (strain K12)
P0A9V2 2.86e-11 67 27 7 222 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V2 0.000323 45 26 0 91 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V3 2.86e-11 67 27 7 222 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
P0A9V3 0.000323 45 26 0 91 3 lptB Lipopolysaccharide export system ATP-binding protein LptB Escherichia coli O157:H7
Q88ZJ6 2.94e-11 68 28 7 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6G529 2.96e-11 66 28 6 187 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q39GT7 3.03e-11 67 27 6 202 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39GT7 3.07e-05 49 27 3 170 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2RWI9 3.22e-11 68 30 5 176 3 modC Molybdenum import ATP-binding protein ModC Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q04G50 3.34e-11 68 29 8 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q03PY5 3.38e-11 67 27 5 214 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03PY5 0.000179 47 26 3 172 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8PP41 3.38e-11 67 30 5 170 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q8PP41 3.13e-08 58 29 7 199 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q6D2F6 3.75e-11 68 29 7 196 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6D2F6 0.00041 46 24 6 215 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O34512 3.84e-11 68 32 8 205 3 yfmM Uncharacterized ABC transporter ATP-binding protein YfmM Bacillus subtilis (strain 168)
O34512 2.93e-07 56 31 7 176 3 yfmM Uncharacterized ABC transporter ATP-binding protein YfmM Bacillus subtilis (strain 168)
Q8XPK6 4.35e-11 68 29 6 202 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8XPK6 6.07e-05 49 27 1 100 3 xylG Xylose import ATP-binding protein XylG Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8DMX9 4.39e-11 67 28 5 189 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 4.39e-11 67 28 5 189 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 4.39e-11 67 28 5 189 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q2K0S7 4.6e-11 68 25 18 478 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K0S7 1.29e-05 51 27 5 190 3 rbsA3 Ribose import ATP-binding protein RbsA 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q03AH0 4.78e-11 67 30 8 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q0K2U3 5.01e-11 66 28 5 201 3 tauB Taurine import ATP-binding protein TauB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q65UG3 5.2e-11 66 26 4 212 3 znuC Zinc import ATP-binding protein ZnuC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65UG3 5.03e-05 48 26 3 145 3 znuC Zinc import ATP-binding protein ZnuC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9K7C3 5.4e-11 68 23 18 491 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K7C3 0.000148 48 24 1 112 3 araG L-arabinose transport ATP-binding protein AraG Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O84421 5.8e-11 65 29 1 133 3 CT_416 Probable metal transport system ATP-binding protein CT_416 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P44735 5.87e-11 68 22 8 351 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44735 1.84e-05 50 26 0 92 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44735 2.1e-05 50 30 6 173 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QP85 5.98e-11 67 28 7 200 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q4QP85 1.38e-05 50 27 7 184 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q8XJX3 6.03e-11 68 21 13 471 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q8XJX3 8.87e-06 52 37 1 70 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain 13 / Type A)
Q03PY6 6.07e-11 66 25 12 294 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q03PY6 0.000134 47 36 2 83 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0TPX5 6.35e-11 68 21 13 471 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0TPX5 8.42e-06 52 37 1 70 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
O34362 6.5e-11 68 22 17 486 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 4e-10 65 26 5 209 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q5ZWE4 6.57e-11 67 28 5 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q03CA4 6.63e-11 68 22 13 436 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q03CA4 1.38e-07 57 25 5 198 3 rbsA Ribose import ATP-binding protein RbsA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
P59852 6.8e-11 68 26 9 251 1 lagD Lactococcin-G-processing and transport ATP-binding protein LagD Lactococcus lactis subsp. lactis
Q5KYS1 6.86e-11 68 20 10 470 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
Q5KYS1 2.17e-05 50 26 0 89 3 xylG Xylose import ATP-binding protein XylG Geobacillus kaustophilus (strain HTA426)
P63400 6.89e-11 68 26 16 430 3 BQ2027_MB2353C Uncharacterized ABC transporter ATP-binding protein Mb2353c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63400 1.02e-05 52 26 6 207 3 BQ2027_MB2353C Uncharacterized ABC transporter ATP-binding protein Mb2353c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P63400 0.000184 47 28 4 190 3 BQ2027_MB2353C Uncharacterized ABC transporter ATP-binding protein Mb2353c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQI7 6.89e-11 68 26 16 430 1 Rv2326c Uncharacterized ABC transporter ATP-binding protein Rv2326c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI7 1.02e-05 52 26 6 207 1 Rv2326c Uncharacterized ABC transporter ATP-binding protein Rv2326c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI7 0.000184 47 28 4 190 1 Rv2326c Uncharacterized ABC transporter ATP-binding protein Rv2326c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI6 6.89e-11 68 26 16 430 3 MT2388 Uncharacterized ABC transporter ATP-binding protein MT2388 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQI6 1.02e-05 52 26 6 207 3 MT2388 Uncharacterized ABC transporter ATP-binding protein MT2388 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WQI6 0.000184 47 28 4 190 3 MT2388 Uncharacterized ABC transporter ATP-binding protein MT2388 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1TXH7 6.9e-11 67 27 7 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q87ZE0 7.2e-11 68 23 17 468 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q87ZE0 5.07e-05 49 26 0 102 3 PSPTO_3489 Putative ribose/galactose/methyl galactoside import ATP-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8E7N9 7.24e-11 67 22 19 476 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q8E7N9 2.27e-06 53 23 3 195 3 rbsA Ribose import ATP-binding protein RbsA Streptococcus agalactiae serotype III (strain NEM316)
Q0SSJ0 7.99e-11 67 21 13 467 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q0SSJ0 9.27e-06 51 37 1 70 3 rbsA Ribose import ATP-binding protein RbsA Clostridium perfringens (strain SM101 / Type A)
Q7MG07 8.52e-11 67 20 13 438 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q7MG07 0.000345 46 27 0 77 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain YJ016)
Q8FKF5 8.52e-11 65 28 5 203 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FKF5 0.000151 47 35 1 74 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KXJ6 8.74e-11 67 30 7 206 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KXJ6 9.15e-06 52 26 4 220 3 SCO2324 Putative ABC transporter ATP-binding protein SCO2324 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8D4H4 9.22e-11 67 20 13 438 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q8D4H4 0.000345 46 27 0 77 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio vulnificus (strain CMCP6)
Q92G36 9.22e-11 65 25 6 213 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q8KFD6 9.26e-11 66 28 7 223 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P44692 9.33e-11 65 27 4 212 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44692 0.000137 47 28 4 145 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q30V33 9.62e-11 67 29 9 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1WVI7 1.08e-10 66 26 6 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q64SQ6 1.08e-10 67 30 6 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q55281 1.1e-10 65 27 4 171 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q55281 0.000226 46 22 4 196 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0T7M2 1.14e-10 65 29 5 203 3 tauB Taurine import ATP-binding protein TauB Shigella flexneri serotype 5b (strain 8401)
Q5LBT4 1.14e-10 67 30 6 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
P50332 1.16e-10 66 30 6 225 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
P50332 2.95e-05 49 27 6 191 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
Q2K204 1.2e-10 67 23 10 447 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2K204 0.001 45 31 1 70 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q4QND5 1.27e-10 65 27 4 212 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain 86-028NP)
Q4QND5 0.000246 46 28 4 145 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain 86-028NP)
Q6CYU2 1.27e-10 65 30 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6CYU2 1.42e-07 56 28 5 191 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5PDF8 1.33e-10 65 28 7 221 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5PDF8 4.91e-06 51 30 6 203 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0VTB6 1.37e-10 65 31 3 182 3 znuC Zinc import ATP-binding protein ZnuC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q0VTB6 1.95e-07 55 26 5 193 3 znuC Zinc import ATP-binding protein ZnuC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
D4GSY7 1.38e-10 65 27 6 220 3 HVO_1886 Probable anion import ATP-binding protein HVO_1886 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O34979 1.42e-10 64 30 9 204 3 yvrO Uncharacterized ABC transporter ATP-binding protein YvrO Bacillus subtilis (strain 168)
Q9CM08 1.47e-10 67 20 12 465 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q9CM08 0.000293 47 27 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Pasteurella multocida (strain Pm70)
Q471U2 1.48e-10 65 28 5 187 3 tauB Taurine import ATP-binding protein TauB Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q13LX0 1.48e-10 67 22 13 473 3 rbsA Ribose import ATP-binding protein RbsA Paraburkholderia xenovorans (strain LB400)
Q13LX0 7.65e-07 55 26 6 221 3 rbsA Ribose import ATP-binding protein RbsA Paraburkholderia xenovorans (strain LB400)
Q13LX0 0.000218 47 21 3 248 3 rbsA Ribose import ATP-binding protein RbsA Paraburkholderia xenovorans (strain LB400)
O69063 1.52e-10 66 29 6 198 3 htxD Hypophosphite import ATP-binding protein HtxD Stutzerimonas stutzeri
Q1RFH8 1.53e-10 65 28 5 203 3 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain UTI89 / UPEC)
Q1RFH8 0.000138 47 35 1 74 3 tauB Taurine import ATP-binding protein TauB Escherichia coli (strain UTI89 / UPEC)
Q0TKS1 1.53e-10 65 28 5 203 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TKS1 0.000138 47 35 1 74 3 tauB Taurine import ATP-binding protein TauB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q65UW1 1.58e-10 67 21 14 456 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65UW1 4.88e-05 49 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5X627 1.63e-10 66 29 6 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q63P06 1.65e-10 67 24 13 491 3 rbsA Ribose import ATP-binding protein RbsA Burkholderia pseudomallei (strain K96243)
Q1WSB9 1.67e-10 65 27 8 239 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q1WSB9 3.32e-08 58 26 6 199 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q2NU23 1.7e-10 64 29 6 191 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Sodalis glossinidius (strain morsitans)
Q5KUX3 1.7e-10 66 21 15 463 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 1.68e-07 57 26 6 209 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q5KUX3 0.000607 45 30 0 80 3 rbsA Ribose import ATP-binding protein RbsA Geobacillus kaustophilus (strain HTA426)
Q1Q889 1.71e-10 64 27 3 151 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1Q889 1.28e-09 62 31 6 200 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1BG75 1.73e-10 65 26 3 216 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
Q1BG75 1.81e-05 50 28 7 183 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia orbicola (strain AU 1054)
A0KE71 1.73e-10 65 26 3 216 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
A0KE71 1.81e-05 50 28 7 183 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Burkholderia cenocepacia (strain HI2424)
Q9KSD1 1.74e-10 66 19 15 453 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KSD1 0.000443 46 27 0 77 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A3DJK3 1.78e-10 65 24 7 209 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q6G0V9 1.82e-10 63 26 6 205 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Bartonella quintana (strain Toulouse)
P45046 1.84e-10 66 26 8 226 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45046 2.27e-07 57 21 13 476 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45046 1.26e-05 51 26 1 126 3 xylG Xylose import ATP-binding protein XylG Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q55EH8 1.87e-10 67 28 7 208 3 abcG23 ABC transporter G family member 23 Dictyostelium discoideum
Q9HNI8 1.89e-10 65 32 5 181 3 phnC Phosphonates import ATP-binding protein PhnC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8UH62 1.91e-10 65 27 4 205 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2JPW6 1.92e-10 65 26 4 223 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q2JPW6 4.57e-06 51 24 6 240 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
P23703 1.92e-10 65 24 8 239 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P23703 3.67e-07 55 27 5 204 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q31YV7 1.98e-10 66 20 12 479 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q31YV7 3.36e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella boydii serotype 4 (strain Sb227)
Q663Y5 2e-10 66 22 11 459 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q663Y5 1.86e-07 57 26 7 199 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q663Y5 0.000297 47 31 1 67 3 xylG Xylose import ATP-binding protein XylG Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CDC0 2e-10 66 22 11 459 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDC0 1.86e-07 57 26 7 199 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDC0 0.000297 47 31 1 67 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CFR2 2e-10 66 22 11 459 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q7CFR2 1.86e-07 57 26 7 199 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q7CFR2 0.000297 47 31 1 67 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis
Q1C0D5 2e-10 66 22 11 459 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C0D5 1.86e-07 57 26 7 199 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C0D5 0.000297 47 31 1 67 3 xylG Xylose import ATP-binding protein XylG Yersinia pestis bv. Antiqua (strain Antiqua)
Q82B58 2.01e-10 66 29 7 206 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q82B58 5.86e-05 49 26 5 218 3 SAV_5847 Putative ABC transporter ATP-binding protein SAV_5847 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q160Y9 2.01e-10 64 26 5 209 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q160Y9 1.4e-06 53 26 5 182 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8TQW9 2.01e-10 66 25 10 327 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 3.04e-05 50 22 4 223 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 5.69e-05 49 26 7 194 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P44513 2.03e-10 65 28 7 199 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44513 8.44e-05 48 26 6 184 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q21UI2 2.04e-10 65 29 3 174 3 modC Molybdenum import ATP-binding protein ModC Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q04FM1 2.16e-10 65 29 5 206 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q04FM1 7.37e-05 48 24 7 208 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q5YRK2 2.21e-10 64 30 8 209 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Nocardia farcinica (strain IFM 10152)
Q5YRK2 2.99e-06 52 27 3 166 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Nocardia farcinica (strain IFM 10152)
Q58429 2.24e-10 64 26 6 208 3 MJ1023 Uncharacterized ABC transporter ATP-binding protein MJ1023 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58429 4.17e-07 54 25 1 127 3 MJ1023 Uncharacterized ABC transporter ATP-binding protein MJ1023 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P37774 2.25e-10 64 30 6 171 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
P37774 7.39e-07 53 25 6 209 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q6DB03 2.27e-10 66 22 12 477 3 xylG Xylose import ATP-binding protein XylG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6DB03 1.37e-06 54 26 7 199 3 xylG Xylose import ATP-binding protein XylG Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5NN23 2.28e-10 64 29 6 224 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q6FFL0 2.29e-10 64 25 4 192 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6FFL0 5.02e-09 60 29 4 159 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A0KPH6 2.3e-10 64 29 3 166 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A0KPH6 9.29e-10 62 25 4 219 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8REG7 2.31e-10 64 25 6 198 3 phnC Phosphonates import ATP-binding protein PhnC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8TIX0 2.32e-10 65 28 6 205 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TIX0 3.51e-08 58 25 3 197 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A3CRB8 2.33e-10 64 27 5 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
A3CRB8 4.84e-06 51 26 6 203 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q68Y13 2.36e-10 64 25 5 211 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q68Y13 5.37e-05 48 21 4 185 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P23924 2.39e-10 66 20 13 472 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23924 2.95e-05 50 29 0 79 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O05253 2.45e-10 66 21 10 428 1 nupO Guanosine import ATP-binding protein NupO Bacillus subtilis (strain 168)
Q56953 2.48e-10 65 25 6 206 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q56953 1.8e-08 59 24 4 196 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q4QN44 2.49e-10 66 22 8 351 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q4QN44 5.78e-06 52 27 0 92 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q4QN44 2.12e-05 50 30 6 166 3 rbsA Ribose import ATP-binding protein RbsA Haemophilus influenzae (strain 86-028NP)
Q3MB44 2.57e-10 66 24 17 461 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3MB44 4.49e-05 49 25 5 203 3 rbsA Ribose import ATP-binding protein RbsA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9Z3I3 2.61e-10 65 29 7 210 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q9Z3I3 7.29e-06 51 28 5 180 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q3Z5U5 2.63e-10 63 26 4 219 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q3Z5U5 0.000177 46 27 6 208 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella sonnei (strain Ss046)
Q83CV2 2.92e-10 63 29 7 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q0S0Z3 2.95e-10 65 29 7 196 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q0S0Z3 2.55e-05 50 31 1 86 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
O34641 2.98e-10 64 24 5 231 2 ytrB ABC transporter ATP-binding protein YtrB Bacillus subtilis (strain 168)
O34641 3.14e-09 61 26 8 214 2 ytrB ABC transporter ATP-binding protein YtrB Bacillus subtilis (strain 168)
Q734T1 3.02e-10 66 23 15 499 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q48HL2 3.04e-10 64 28 8 210 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8X5D9 3.16e-10 65 19 12 469 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q8X5D9 3.19e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O157:H7
Q4ZSF3 3.2e-10 65 21 7 332 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q4ZSF3 2.14e-05 50 27 1 101 3 xylG Xylose import ATP-binding protein XylG Pseudomonas syringae pv. syringae (strain B728a)
Q8PZN0 3.32e-10 65 26 5 237 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PZN0 1.32e-05 51 25 8 191 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5PB72 3.34e-10 63 23 6 241 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma marginale (strain St. Maries)
Q5PB72 0.000244 46 34 1 63 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma marginale (strain St. Maries)
Q4FMG5 3.37e-10 64 26 5 191 3 tauB Taurine import ATP-binding protein TauB Pelagibacter ubique (strain HTCC1062)
Q4FMG5 0.000741 45 25 5 184 3 tauB Taurine import ATP-binding protein TauB Pelagibacter ubique (strain HTCC1062)
Q8A1M1 3.49e-10 63 29 6 173 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q13RB6 3.89e-10 65 26 9 232 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q13RB6 1.59e-08 60 21 18 488 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q13RB6 0.000122 48 26 0 78 3 xylG Xylose import ATP-binding protein XylG Paraburkholderia xenovorans (strain LB400)
Q8FFU7 4.08e-10 65 19 12 469 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8FFU7 3.21e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFU2 4.08e-10 65 19 12 469 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0TFU2 3.21e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q2GE91 4.35e-10 63 29 4 158 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q5LVC2 4.38e-10 63 31 9 191 3 phnC Phosphonates import ATP-binding protein PhnC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1GKZ0 4.41e-10 63 28 8 219 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Ruegeria sp. (strain TM1040)
Q87MK8 4.43e-10 62 31 6 173 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2GFZ6 4.45e-10 63 25 6 233 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q8ZRV2 4.46e-10 63 28 6 221 1 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZRV2 1.35e-05 50 30 6 203 1 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5E0B3 4.77e-10 63 29 6 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q57855 4.8e-10 63 23 3 214 3 MJ0412 Uncharacterized ABC transporter ATP-binding protein MJ0412 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q7VP69 4.94e-10 62 28 4 184 3 thiQ Thiamine import ATP-binding protein ThiQ Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8Z9I6 4.99e-10 63 28 7 221 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhi
Q8Z9I6 4.2e-06 51 30 6 203 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella typhi
Q1RGL1 4.99e-10 63 24 5 210 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia bellii (strain RML369-C)
Q1RGL1 9.97e-06 50 23 5 175 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia bellii (strain RML369-C)
Q57242 5.18e-10 65 26 5 219 3 uup ATP-binding protein Uup Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q04EY5 5.19e-10 63 30 6 202 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q146E7 5.2e-10 63 27 4 201 3 tauB1 Taurine import ATP-binding protein TauB 1 Paraburkholderia xenovorans (strain LB400)
Q0SBZ1 5.25e-10 64 27 4 193 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q0SBZ1 4.34e-05 49 31 1 87 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q57TF5 5.27e-10 63 28 7 221 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella choleraesuis (strain SC-B67)
Q57TF5 4.82e-06 51 30 6 203 3 thiQ Thiamine import ATP-binding protein ThiQ Salmonella choleraesuis (strain SC-B67)
Q0B1U4 5.3e-10 65 21 9 336 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0B1U4 0.000424 46 25 0 78 3 xylG Xylose import ATP-binding protein XylG Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1LKJ2 5.33e-10 63 29 6 200 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1LKJ2 5.65e-07 54 28 3 169 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8TK65 5.41e-10 65 24 7 297 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TK65 1.14e-05 51 26 9 199 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q11C01 5.65e-10 65 22 12 458 3 rbsA Ribose import ATP-binding protein RbsA Chelativorans sp. (strain BNC1)
Q2T8T6 5.66e-10 65 23 13 491 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q21XJ9 5.69e-10 63 28 6 217 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21XJ9 3.06e-07 55 25 5 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B1JLQ0 5.71e-10 65 22 12 466 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q97KD5 5.92e-10 63 25 5 208 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P21630 6.02e-10 62 30 3 162 3 braG High-affinity branched-chain amino acid transport ATP-binding protein BraG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21630 0.001 44 25 4 200 3 braG High-affinity branched-chain amino acid transport ATP-binding protein BraG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3JHZ1 6.02e-10 65 23 13 491 3 rbsA2 Ribose import ATP-binding protein RbsA 2 Burkholderia pseudomallei (strain 1710b)
Q7VNG4 6.16e-10 64 29 5 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3Z057 6.39e-10 65 19 12 469 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
Q3Z057 3.19e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella sonnei (strain Ss046)
P0AAG9 6.39e-10 65 19 12 469 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG9 3.19e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri
P0AAG8 6.39e-10 65 19 12 469 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
P0AAG8 3.19e-05 50 29 0 79 1 mglA Galactose/methyl galactoside import ATP-binding protein MglA Escherichia coli (strain K12)
A7FMJ7 6.4e-10 65 22 12 466 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q0VR80 6.46e-10 62 25 5 213 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8DB62 6.47e-10 62 30 5 170 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Vibrio vulnificus (strain CMCP6)
Q7MIR0 6.66e-10 62 30 5 170 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Vibrio vulnificus (strain YJ016)
Q576H3 6.74e-10 65 20 16 482 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q576H3 4.83e-08 58 26 8 220 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q576H3 0.000273 47 25 0 78 3 xylG Xylose import ATP-binding protein XylG Brucella abortus biovar 1 (strain 9-941)
Q2YJE7 6.74e-10 65 20 16 482 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q2YJE7 4.83e-08 58 26 8 220 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q2YJE7 0.000273 47 25 0 78 3 xylG Xylose import ATP-binding protein XylG Brucella abortus (strain 2308)
Q8RGC8 6.86e-10 64 29 8 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q6LG59 6.88e-10 64 20 17 494 3 mglA2 Galactose/methyl galactoside import ATP-binding protein MglA 2 Photobacterium profundum (strain SS9)
Q5FL41 7.09e-10 64 29 9 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
E9PU17 7.2e-10 65 27 7 211 2 Abca17 ATP-binding cassette sub-family A member 17 Rattus norvegicus
E9PU17 8.52e-05 49 21 5 217 2 Abca17 ATP-binding cassette sub-family A member 17 Rattus norvegicus
Q65SC9 7.43e-10 62 27 9 234 3 thiQ Thiamine import ATP-binding protein ThiQ Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q65SC9 4.27e-07 54 27 4 182 3 thiQ Thiamine import ATP-binding protein ThiQ Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q38VW6 7.89e-10 63 30 9 202 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q84M24 7.99e-10 65 27 7 214 2 ABCA1 ABC transporter A family member 1 Arabidopsis thaliana
Q84M24 0.001 45 21 9 262 2 ABCA1 ABC transporter A family member 1 Arabidopsis thaliana
Q9ZCC4 8.2e-10 62 25 6 212 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia prowazekii (strain Madrid E)
Q72FW5 8.23e-10 63 28 9 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q4FQ27 8.35e-10 62 27 3 151 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q4FQ27 2.1e-09 61 30 4 200 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q4UJW5 8.43e-10 62 24 6 213 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A0LM36 8.48e-10 65 28 5 198 3 macB Macrolide export ATP-binding/permease protein MacB Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q4ZU82 8.53e-10 63 28 8 210 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q8YDN0 8.55e-10 64 21 16 477 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YDN0 2.32e-07 57 25 8 221 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8YDN0 0.00027 47 25 0 78 3 xylG Xylose import ATP-binding protein XylG Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q65P77 8.55e-10 63 28 5 189 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q65P77 0.000173 47 23 4 191 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q4KC87 8.77e-10 63 29 8 194 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4KC87 7.42e-05 48 25 9 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0T2X5 8.77e-10 64 19 12 469 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q0T2X5 3.1e-05 50 29 0 79 3 mglA Galactose/methyl galactoside import ATP-binding protein MglA Shigella flexneri serotype 5b (strain 8401)
Q665B6 8.81e-10 63 29 6 206 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q665B6 1.18e-07 56 28 7 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q39GY8 9.02e-10 64 24 13 488 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q66EY9 9.25e-10 64 22 12 466 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3G1 9.25e-10 64 22 12 466 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q6LPK2 9.36e-10 62 28 5 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photobacterium profundum (strain SS9)
Q98DT6 9.49e-10 62 34 5 169 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1BQ82 9.68e-10 64 21 10 452 3 Bcen_3328 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia orbicola (strain AU 1054)
A0B297 9.68e-10 64 21 10 452 3 Bcen2424_5039 Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 Burkholderia cenocepacia (strain HI2424)
Q52733 1e-09 62 31 7 182 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Rhizobium etli
Q2K396 1e-09 62 31 7 182 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q97WT4 1.02e-09 64 22 18 495 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97WT4 5.03e-07 55 25 5 207 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
O54187 1.05e-09 63 28 7 210 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q1BWN5 1.1e-09 64 24 15 489 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia orbicola (strain AU 1054)
A0K718 1.1e-09 64 24 15 489 3 rbsA1 Ribose import ATP-binding protein RbsA 1 Burkholderia cenocepacia (strain HI2424)
A1B9H9 1.12e-09 62 24 5 206 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
A1B9H9 2.42e-06 52 29 8 179 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paracoccus denitrificans (strain Pd 1222)
Q1GBJ0 1.14e-09 62 25 7 214 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q1GBJ0 8.56e-06 51 26 6 199 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q71WH7 1.19e-09 62 27 5 202 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q5E3S7 1.2e-09 61 30 6 180 3 ccmA Cytochrome c biogenesis ATP-binding export protein CcmA Aliivibrio fischeri (strain ATCC 700601 / ES114)
P42246 1.24e-09 63 21 3 224 3 ycbN Uncharacterized ABC transporter ATP-binding protein YcbN Bacillus subtilis (strain 168)
P42246 1.99e-09 62 24 4 195 3 ycbN Uncharacterized ABC transporter ATP-binding protein YcbN Bacillus subtilis (strain 168)
Q7NA79 1.29e-09 63 21 12 479 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7NA79 2.98e-05 50 32 1 75 3 rbsA Ribose import ATP-binding protein RbsA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q88XV1 1.34e-09 62 28 6 206 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88XV1 1.11e-06 53 27 6 194 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9PJX9 1.36e-09 62 29 1 133 3 TC_0697 Probable metal transport system ATP-binding protein TC_0697 Chlamydia muridarum (strain MoPn / Nigg)
Q13FD9 1.42e-09 63 22 14 444 3 Bxeno_C1272 Putative ribose/galactose/methyl galactoside import ATP-binding protein Paraburkholderia xenovorans (strain LB400)
Q13FD9 0.000587 46 24 6 220 3 Bxeno_C1272 Putative ribose/galactose/methyl galactoside import ATP-binding protein Paraburkholderia xenovorans (strain LB400)
Q0BN75 1.45e-09 61 28 4 166 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain OSU18)
Q8UBN2 1.46e-09 63 20 8 332 3 Atu2819 Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8P2L5 1.49e-09 62 28 8 200 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8P2L5 0.000875 45 20 5 188 3 oppF Oligopeptide transport ATP-binding protein OppF Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5NHP2 1.51e-09 61 28 4 166 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q2A4V5 1.51e-09 61 28 4 166 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. holarctica (strain LVS)
Q14J44 1.51e-09 61 28 4 166 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Francisella tularensis subsp. tularensis (strain FSC 198)
P22040 1.52e-09 63 23 5 230 3 sll0415 Uncharacterized ABC transporter ATP-binding protein sll0415 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P22040 5.63e-09 61 30 7 196 3 sll0415 Uncharacterized ABC transporter ATP-binding protein sll0415 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6D664 1.58e-09 61 27 7 214 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0B5V4 1.59e-09 63 27 6 210 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4WER4 1.59e-09 63 23 16 494 3 lsrA Autoinducer 2 import ATP-binding protein LsrA Enterobacter sp. (strain 638)
Q6F0P3 1.62e-09 62 27 5 180 3 phnC Phosphonates import ATP-binding protein PhnC Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q1BJW2 1.66e-09 63 26 5 209 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia orbicola (strain AU 1054)
A0B3Z7 1.66e-09 63 26 5 209 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia cenocepacia (strain HI2424)
Q2T4S8 1.72e-09 63 26 5 209 3 araG2 Arabinose import ATP-binding protein AraG 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1CDR0 1.73e-09 62 27 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q1CDR0 4.33e-07 55 27 7 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 1.73e-09 62 27 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q74PI5 4.33e-07 55 27 7 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 1.73e-09 62 27 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q1C1S0 4.33e-07 55 27 7 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q042G7 1.75e-09 63 29 11 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5F8K2 1.79e-09 61 31 7 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8UBB7 1.8e-09 63 25 4 209 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q73YZ5 1.82e-09 61 26 6 235 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q73YZ5 1.6e-06 53 27 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 1.82e-09 61 26 6 235 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
A0QFE1 1.6e-06 53 27 6 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q0I348 1.85e-09 63 23 12 483 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q0I348 1.67e-08 60 24 6 223 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q0I348 1.31e-05 51 34 1 67 3 xylG Xylose import ATP-binding protein XylG Histophilus somni (strain 129Pt)
Q1J982 1.87e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q38WL5 1.9e-09 62 26 8 245 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q48QM2 1.9e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.9e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.9e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
O06980 1.92e-09 62 26 8 232 3 yvcR Uncharacterized ABC transporter ATP-binding protein YvcR Bacillus subtilis (strain 168)
A0ALT7 1.94e-09 62 27 5 202 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q74K65 2e-09 62 29 11 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8FAV1 2.02e-09 62 29 7 177 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1I7I9 2.07e-09 63 28 7 202 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q1I7I9 0.000155 48 29 5 181 3 pvdT Pyoverdine export ATP-binding/permease protein PvdT Pseudomonas entomophila (strain L48)
Q03I83 2.11e-09 62 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 2.11e-09 62 26 5 221 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 2.11e-09 62 26 5 221 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q2NTI7 2.13e-09 61 28 6 223 3 znuC Zinc import ATP-binding protein ZnuC Sodalis glossinidius (strain morsitans)
Q2NTI7 0.000118 47 26 7 220 3 znuC Zinc import ATP-binding protein ZnuC Sodalis glossinidius (strain morsitans)
Q1BGC0 2.16e-09 63 21 11 461 3 Bcen_6474 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia orbicola (strain AU 1054)
A0KE25 2.16e-09 63 21 11 461 3 Bcen2424_6709 Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 Burkholderia cenocepacia (strain HI2424)
P0C0E9 2.24e-09 62 29 9 224 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 2.24e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 2.24e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 2.24e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 2.24e-09 62 29 9 224 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00660
Feature type CDS
Gene modF
Product molybdate ABC transporter ATP-binding protein ModF
Location 136943 - 138394 (strand: -1)
Length 1452 (nucleotides) / 483 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1547
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1119 Inorganic ion transport and metabolism (P) P ABC-type molybdenum transport system, ATPase component ModF/photorepair protein PhrA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05776 molybdate transport system ATP-binding protein ABC transporters -

Protein Sequence

MTHLHITRGIFRTGPDSSLSVPSLRLERGQHHAFIGANGSGKSTFARALTQELALLSGEMTSAFIRPVRVAFDTLQTLVDDEWSRNNTDFIDNNETDNGRTTADIIQLTYRDDACCLALASQFGIAGSLTRRFKYLSTGETRKVLLCQALMSEPDLLVLDEPYDGLDTASRLMLSEMLTTLAQTGLTIILILNRFSDIPDFITRAGLLANSKLSEPQALSDVLQSQLSHSEQNEHLTLPEQDNPASERLSSDLARVILNHGTVSYNDKPILRDLTWQVLPAEHWQITGENGAGKSTLLSLITGDHPQGYSNDLTLFGRRRGSGETVWDIKQHIGYVSNSVHLGYRVSINVRNTIISGFFDSVGLYQKPSDRQIKLADDWLVLLGLTSVSESPFHSLSWGQQRLVLIARALVKHPALLILDEPLQGLDALNRLLVLRFIDIMISRGDTQLLFVSHHSEDTPACINRRLAFIPENNHYRYEISKL

Flanking regions ( +/- flanking 50bp)

ACGAACCTGCAGTTTGAATGAATAAGGGTATAATAATAAGGCTGCCTGCTATGACACATCTGCACATCACCCGGGGGATCTTCCGGACAGGTCCTGATTCTTCACTTTCCGTTCCGTCATTACGTCTGGAGAGGGGTCAGCACCATGCTTTTATCGGTGCTAACGGCAGCGGTAAATCCACTTTTGCGCGGGCGCTGACACAAGAGCTTGCACTGCTTTCCGGGGAAATGACATCAGCATTTATCCGCCCTGTCCGTGTGGCATTTGATACATTACAGACACTTGTTGATGATGAATGGAGCCGCAACAATACTGATTTTATTGATAATAATGAGACTGATAACGGGCGCACAACCGCAGATATTATTCAGCTGACATACAGAGATGATGCGTGCTGTCTGGCGCTGGCATCACAGTTTGGTATTGCGGGGAGCCTCACGCGGCGCTTTAAATATCTCTCCACCGGCGAAACCCGCAAAGTTCTGCTGTGTCAGGCGCTGATGTCTGAGCCGGATCTGTTGGTGCTTGATGAGCCTTATGACGGGCTGGATACCGCTTCCAGACTGATGCTCAGTGAAATGCTTACCACACTTGCACAAACCGGACTGACCATCATTCTTATTCTTAACCGGTTCAGCGATATTCCGGACTTCATTACCCGCGCGGGGTTACTGGCGAATAGTAAATTATCGGAACCACAGGCACTGTCTGATGTTTTACAATCCCAGCTGAGTCACAGTGAACAAAATGAACATCTCACATTGCCGGAGCAGGATAATCCGGCTTCTGAACGGCTCTCATCTGATCTTGCGCGGGTTATTCTTAATCACGGCACCGTCAGTTATAACGATAAGCCTATTCTTCGCGATTTAACCTGGCAGGTTCTGCCCGCAGAGCACTGGCAGATTACCGGCGAAAACGGCGCGGGGAAATCCACCCTGCTCAGTCTTATCACCGGCGATCACCCGCAGGGATACAGCAATGACCTGACACTTTTTGGCCGCCGCCGGGGCAGTGGTGAAACCGTGTGGGATATCAAACAACATATCGGTTATGTCAGTAATAGTGTTCATCTGGGCTACCGCGTCAGTATTAATGTGCGCAATACGATTATTTCCGGCTTCTTCGATTCTGTCGGCCTGTATCAGAAACCCTCTGACCGGCAGATAAAACTGGCGGATGACTGGCTCGTGCTGCTGGGGTTGACGTCTGTGAGCGAAAGCCCGTTTCACAGCCTGTCGTGGGGACAACAGCGGCTTGTGCTGATAGCACGCGCGCTGGTAAAACATCCGGCGCTGTTAATCCTCGATGAGCCGTTACAGGGGCTGGATGCGCTTAACCGTCTGCTGGTTTTGCGCTTTATCGATATCATGATAAGCCGTGGTGATACTCAACTATTGTTTGTCAGTCATCACAGCGAAGATACTCCCGCCTGCATTAACCGGCGACTGGCGTTTATTCCTGAAAATAATCACTACCGTTATGAAATCAGTAAGTTGTAAGTCATCCATCAAACGGATGTTTTATTTTTTACCTTAAAAAAACATCCGTT