Homologs in group_235

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03135 FBDBKF_03135 95.7 Morganella morganii S1 zapE cell division protein ZapE
EHELCC_07400 EHELCC_07400 95.7 Morganella morganii S2 zapE cell division protein ZapE
NLDBIP_07725 NLDBIP_07725 95.7 Morganella morganii S4 zapE cell division protein ZapE
LHKJJB_07260 LHKJJB_07260 95.7 Morganella morganii S3 zapE cell division protein ZapE
HKOGLL_03670 HKOGLL_03670 95.7 Morganella morganii S5 zapE cell division protein ZapE
F4V73_RS11785 F4V73_RS11785 87.1 Morganella psychrotolerans zapE cell division protein ZapE
PMI_RS18250 PMI_RS18250 67.1 Proteus mirabilis HI4320 zapE cell division protein ZapE

Distribution of the homologs in the orthogroup group_235

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_235

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64612 1.22e-20 85 65 0 63 1 zapE Cell division protein ZapE Escherichia coli (strain K12)
P64613 1.22e-20 85 65 0 63 3 zapE Cell division protein ZapE Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_20000
Feature type CDS
Gene -
Product AFG1/ZapE family ATPase
Location 16 - 228 (strand: -1)
Length 213 (nucleotides) / 70 (amino acids)
In genomic island -

Contig

Accession ZDB_321
Length 283 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_235
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF03969 AFG1-like ATPase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1485 Cell cycle control, cell division, chromosome partitioning (D) D Cell division protein ZapE (Z ring-associated ATPase), AFG1 superfamily

Protein Sequence

MLTTENENAARRFLALADEFYERKVKLIIQAQSGMDSLYRGQLLSFEFARCLSRLQEMQSEEYLKLPHLV

Flanking regions ( +/- flanking 50bp)

ATATTGCACTGTCGAAAATCTATCACACCGCGCTTTTGTATGAGGTTCCGGTGCTGACCACGGAAAATGAGAATGCGGCGCGGCGTTTTCTGGCGCTGGCGGATGAGTTTTATGAGCGGAAAGTAAAACTGATTATTCAGGCGCAGAGCGGGATGGATTCTCTTTATCGGGGGCAGTTATTGTCCTTTGAGTTCGCCAGATGCCTCTCCCGGCTGCAGGAAATGCAAAGTGAGGAGTACCTGAAACTGCCGCATCTGGTATAATGCGCGCCCCTGAAA