Homologs in group_2208

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16895 FBDBKF_16895 100.0 Morganella morganii S1 fre NAD(P)H-flavin reductase
NLDBIP_16905 NLDBIP_16905 100.0 Morganella morganii S4 fre NAD(P)H-flavin reductase
LHKJJB_16565 LHKJJB_16565 100.0 Morganella morganii S3 fre NAD(P)H-flavin reductase
HKOGLL_17530 HKOGLL_17530 100.0 Morganella morganii S5 fre NAD(P)H-flavin reductase
F4V73_RS18365 F4V73_RS18365 93.6 Morganella psychrotolerans fre NAD(P)H-flavin reductase
PMI_RS17630 PMI_RS17630 71.2 Proteus mirabilis HI4320 fre NAD(P)H-flavin reductase

Distribution of the homologs in the orthogroup group_2208

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2208

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P43129 8.54e-131 371 75 0 233 3 fre NAD(P)H-flavin reductase Photorhabdus luminescens
Q9L6L9 1.23e-126 360 71 0 233 1 fre NAD(P)H-flavin reductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEN1 1.46e-122 350 69 0 233 1 fre NAD(P)H-flavin reductase Escherichia coli (strain K12)
P0AEN2 1.46e-122 350 69 0 233 3 fre NAD(P)H-flavin reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEN3 1.46e-122 350 69 0 233 3 fre NAD(P)H-flavin reductase Escherichia coli O157:H7
P43126 1.32e-80 244 52 3 235 3 fre NAD(P)H-flavin reductase Aliivibrio fischeri
P43127 1.76e-78 238 49 2 236 1 fre NAD(P)H-flavin reductase Vibrio harveyi
P29237 1.09e-58 188 37 3 232 3 luxG Probable flavin reductase Photobacterium leiognathi
P24273 1.42e-55 180 40 2 224 3 luxG Probable flavin reductase Aliivibrio fischeri
P16447 8.9e-51 168 37 2 232 3 luxG Probable flavin reductase Vibrio harveyi
P43128 3.91e-50 164 49 2 163 3 fre NAD(P)H-flavin reductase (Fragment) Vibrio orientalis
P68641 1.9e-33 125 31 6 231 3 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pestis
Q66DP5 3.02e-33 125 31 6 231 1 ascD CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase reductase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7WTJ2 4.96e-25 103 31 3 215 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
Q52126 7.16e-25 103 29 3 226 1 ndoR Naphthalene 1,2-dioxygenase system ferredoxin--NAD(P)(+), reductase component Pseudomonas putida
P19734 5.72e-24 101 30 4 223 1 dmpP Phenol 2-monooxygenase, reductase component DmpP Pseudomonas sp. (strain CF600)
P26395 1.14e-23 100 31 6 227 4 rfbI Protein RfbI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O52378 7.61e-23 97 31 4 224 1 nagAa Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin--NAD(P)(+), reductase component Ralstonia sp.
Q45692 4e-20 90 30 1 211 1 dntAa 2,4-dinitrotoluene dioxygenase system ferredoxin--NAD(+), reductase component Burkholderia sp. (strain RASC)
Q3C1E0 1.2e-18 86 27 3 199 1 tphA1I Terephthalate 1,2-dioxygenase, reductase component 1 Comamonas sp.
P0DPQ8 4.55e-18 84 28 5 221 1 gcoB Aromatic O-demethylase, reductase subunit Amycolatopsis sp. (strain ATCC 39116 / 75iv2)
Q3C1D2 6.51e-18 84 27 3 199 1 tphA1II Terephthalate 1,2-dioxygenase, reductase component 2 Comamonas sp.
Q768T4 1.28e-15 78 26 5 231 1 prmB Propane 2-monooxygenase, reductase component Gordonia sp. (strain TY-5)
P21394 3.66e-13 70 25 4 179 1 xylA Xylene/toluene monooxygenase electron transfer component XylA Pseudomonas putida
A7IPX7 4.83e-13 70 26 2 226 1 xamoF Alkene monooxygenase system, ferredoxin--NAD(+) reductase component Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A8GAC4 1.54e-11 66 26 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Serratia proteamaculans (strain 568)
O85675 1.86e-11 66 24 3 199 1 antC Anthranilate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A0QTU9 2.07e-11 65 26 4 212 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
E9RFT0 2.48e-11 65 25 4 212 1 mimB Propane 2-monooxygenase, reductase component Mycolicibacterium goodii
Q9LCJ4 4.92e-11 64 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Pseudoalteromonas haloplanktis
Q0SJK8 7.23e-11 64 24 4 232 1 prmB Propane 2-monooxygenase, reductase component Rhodococcus jostii (strain RHA1)
P22868 9.67e-11 63 24 3 202 1 mmoC Methane monooxygenase component C Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9K0M8 1.34e-09 60 29 6 172 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9FRJ0 1.37e-09 60 27 3 193 1 sce5135 Ferredoxin--NADP reductase B Sorangium cellulosum (strain So ce56)
A1KSH3 1.45e-09 60 29 6 172 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JVQ3 1.45e-09 60 29 6 172 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2A6 1.45e-09 60 29 6 172 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria meningitidis serogroup C (strain 053442)
Q5QYQ8 3.79e-09 59 27 6 177 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q9LCI9 3.82e-09 59 26 5 161 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Moritella marina
Q9LCI7 6.38e-09 58 24 8 228 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Shewanella putrefaciens
A4TPL2 7.02e-09 58 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis (strain Pestoides F)
Q1CLD8 7.02e-09 58 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZBZ5 7.02e-09 58 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis
Q1C4D5 7.02e-09 58 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLJ3 7.02e-09 58 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8GI14 7.61e-09 58 23 7 239 1 carAd Ferredoxin--NAD(P)(+) reductase CarAd Pseudomonas resinovorans
A6VLY1 9.76e-09 58 28 7 170 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9LCI8 1.23e-08 57 23 8 230 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Shewanella hanedai
A6T526 1.28e-08 57 24 9 230 1 nqrF Na(+)-translocating NADH-quinone reductase subunit F Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q66E01 1.32e-08 57 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9LCJ2 2.16e-08 57 22 8 234 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Colwellia psychrerythraea
Q5F6X5 2.4e-08 57 27 6 172 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1JNZ2 3.76e-08 56 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q12QK1 6.71e-08 55 22 8 236 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q605A0 7.22e-08 55 24 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q15YQ1 7.36e-08 55 23 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q65VU9 7.51e-08 55 27 6 168 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UAX6 8.82e-08 55 27 7 170 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Haemophilus influenzae (strain PittEE)
O05012 9.33e-08 55 27 7 170 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4FPV2 1.02e-07 55 28 7 164 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A6VW13 2.07e-07 54 24 5 161 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Marinomonas sp. (strain MWYL1)
Q03304 2.52e-07 53 24 6 206 1 tmoF Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component Pseudomonas mendocina
Q9CLA6 2.96e-07 53 27 7 171 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Pasteurella multocida (strain Pm70)
Q4QP19 3.04e-07 53 27 7 170 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Haemophilus influenzae (strain 86-028NP)
Q7VNU4 3.26e-07 53 27 7 170 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1Q7Z7 4.05e-07 53 22 8 231 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q9LCJ0 5.22e-07 53 22 7 230 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9LCJ1 9.93e-07 52 26 3 108 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F (Fragment) Photobacterium phosphoreum
P07771 2.1e-06 51 24 8 207 1 benC Benzoate 1,2-dioxygenase electron transfer component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q54NC1 2.11e-06 50 26 8 178 3 cyb5r1 NADH-cytochrome b5 reductase 1 Dictyostelium discoideum
Q9X4Q8 2.15e-06 51 22 8 236 1 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y4 2.15e-06 51 22 8 236 1 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9RFV6 3.85e-06 50 22 9 230 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio campbellii (strain ATCC BAA-1116)
A3MYM7 7.57e-06 49 24 5 167 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I5Y1 7.84e-06 49 27 7 165 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Histophilus somni (strain 129Pt)
Q8U2E4 1.12e-05 48 27 6 185 1 hydG Sulfhydrogenase 1 subunit gamma Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q255Y6 1.55e-05 48 32 4 90 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia felis (strain Fe/C-56)
P39662 1.57e-05 48 23 7 215 1 hmp Flavohemoprotein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q7UIY1 1.7e-05 48 26 8 223 3 hmp Flavohemoprotein Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8GAZ4 2.48e-05 48 28 6 149 3 hmp Flavohemoprotein Burkholderia sp. (strain TH2)
Q75R59 2.64e-05 48 21 7 230 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio anguillarum
Q7MID2 3.72e-05 47 25 3 108 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio vulnificus (strain YJ016)
Q8DBJ1 3.72e-05 47 25 3 108 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Vibrio vulnificus (strain CMCP6)
E7FHW8 6.52e-05 46 25 10 206 1 shyC Sulfhydrogenase 2 subunit gamma Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q7WUM8 6.78e-05 47 23 6 199 3 hmp Flavohemoprotein Rhizobium meliloti (strain 1021)
Q821Q3 7.95e-05 46 31 5 96 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9PLI3 0.000181 45 31 4 90 3 nqrF Na(+)-translocating NADH-quinone reductase subunit F Chlamydia muridarum (strain MoPn / Nigg)
Q9X406 0.00067 43 23 3 167 1 msmD Putative methanesulfonate monooxygenase ferredoxin reductase subunit Methylosulfonomonas methylovora
A7TNL7 0.000827 43 25 4 107 3 CBR1 NADH-cytochrome b5 reductase 1 Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19535
Feature type CDS
Gene fre
Product NAD(P)H-flavin reductase
Location 2836 - 3537 (strand: 1)
Length 702 (nucleotides) / 233 (amino acids)

Contig

Accession ZDB_247
Length 11457 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2208
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00175 Oxidoreductase NAD-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0543 Coenzyme transport and metabolism (H)
Energy production and conversion (C)		 HC NAD(P)H-flavin reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05368 NAD(P)H-flavin reductase [EC:1.5.1.41] Riboflavin metabolism
Metabolic pathways		 -

Protein Sequence

MATLNCKVTSVESITDTVYRIKLLPDGDFSFKAGQYLMVVMDERDKRPFSMASAPSSRQEIELHIGASEFNLYAMAVMDRILDNRRVTIDIPHGKAWFRENSDAPMLLIAGGTGFSYTRSVLLAALEENPQRDITFYWGAREHVYLYDLGELQALAETHPNLKIIPVVEQPDDTWRGRTGTVLSAVLDDFGSLAGKDIYIAGRFEMAKIARERFCQERGADAGRLFGDAFEFI

Flanking regions ( +/- flanking 50bp)

GTTGACGCCATATGGGACGAATTAAATATTCTCGATAATTGAGGGAGCACATGGCAACGTTAAACTGCAAAGTTACCTCTGTTGAATCTATAACGGATACGGTATACCGCATAAAATTATTACCGGATGGTGATTTTTCATTCAAAGCCGGGCAATATCTGATGGTGGTGATGGATGAACGGGATAAGCGCCCGTTCTCAATGGCATCCGCGCCGTCATCCCGGCAGGAAATTGAGCTGCATATCGGAGCATCCGAATTTAATCTTTATGCGATGGCGGTGATGGACCGGATCCTGGATAACCGCCGGGTGACCATTGATATCCCGCACGGCAAAGCCTGGTTCCGGGAAAACAGTGACGCACCGATGCTCCTGATTGCCGGAGGAACCGGTTTTTCTTACACCCGTTCTGTTCTGCTGGCGGCACTGGAAGAAAATCCGCAGCGTGATATCACGTTTTACTGGGGTGCCAGAGAGCATGTTTATCTCTATGACCTCGGTGAATTGCAGGCTCTCGCCGAAACACATCCGAACCTGAAAATTATCCCTGTTGTTGAACAGCCGGATGATACCTGGCGCGGGCGCACCGGTACTGTGCTCAGTGCGGTGCTGGATGATTTTGGTTCACTGGCCGGAAAAGATATCTATATTGCCGGTCGTTTTGAAATGGCCAAAATCGCCCGCGAACGTTTCTGCCAGGAGCGTGGTGCAGATGCCGGCCGCCTGTTTGGTGATGCATTCGAGTTTATTTAAAGAAAATCCCGCCCCCTGACGGCGGGAGTATGCTGATAACAGGTCAGCTA