Homologs in group_2874

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10835 FBDBKF_10835 100.0 Morganella morganii S1 cbiM cobalt transporter CbiM
NLDBIP_15000 NLDBIP_15000 100.0 Morganella morganii S4 cbiM cobalt transporter CbiM
LHKJJB_14345 LHKJJB_14345 100.0 Morganella morganii S3 cbiM cobalt transporter CbiM
HKOGLL_12965 HKOGLL_12965 100.0 Morganella morganii S5 cbiM cobalt transporter CbiM
F4V73_RS16915 F4V73_RS16915 95.2 Morganella psychrotolerans cbiM cobalt transporter CbiM

Distribution of the homologs in the orthogroup group_2874

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2874

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P44274 8.56e-70 214 61 0 197 3 HI_1621 Putative metal transport protein HI_1621 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A9GQ89 7.73e-07 51 30 8 212 3 cbiM Cobalt transport protein CbiM Sorangium cellulosum (strain So ce56)
Q748J7 7.07e-06 49 28 7 214 3 cbiM Cobalt transport protein CbiM Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O28435 7.08e-06 48 33 4 127 3 AF_1843 Putative fused nickel transport protein NikMN Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
D7DR00 2.57e-05 47 25 5 210 3 cbiM Putative cobalt transport protein CbiM Methanococcus voltae (strain ATCC BAA-1334 / A3)
C9YID6 0.000754 42 25 6 218 3 cbiM Cobalt transport protein CbiM Clostridioides difficile (strain R20291)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19420
Feature type CDS
Gene cbiM
Product cobalt transporter CbiM
Location 5707 - 6339 (strand: -1)
Length 633 (nucleotides) / 210 (amino acids)
In genomic island -

Contig

Accession ZDB_245
Length 12471 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2874
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01891 Cobalt uptake substrate-specific transmembrane region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0310 Inorganic ion transport and metabolism (P) P ABC-type Co2+ transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02007 cobalt/nickel transport system permease protein ABC transporters -

Protein Sequence

MHLSEGVLHLPVLAGAGVVAAAGVAIGIRQLDTSRLSLAALFGAAFFVAGTIHVPIGVSSVHLILNGLAGLFLGWAVFPAFLIALALQVLFFSFGGFAVLGVNLCNISIPALLVYYLFRNSLRPGLSQGRLVYLGVMAGVLGTLGTVCLTSLALVLDSGKSYIDLVWLLFIGHLPIFVTDSLISVGILLALAKMRPASLMVNQPGQHTYG

Flanking regions ( +/- flanking 50bp)

TGAATTAACAAAGCAGGCCGCTAAAAACGCCGCATAACAGGAGGAAGACCATGCATTTATCTGAAGGCGTATTACATCTTCCTGTTCTGGCCGGTGCCGGTGTGGTGGCTGCGGCCGGGGTTGCCATCGGCATCCGTCAGCTGGATACCTCGCGTCTGTCGCTGGCAGCCCTGTTCGGGGCGGCATTCTTTGTTGCCGGTACCATCCATGTGCCGATCGGGGTCAGCAGTGTGCATCTGATCTTAAACGGACTTGCCGGATTGTTCCTCGGCTGGGCGGTTTTTCCGGCATTCCTGATTGCCCTCGCGCTGCAGGTGCTGTTTTTCTCCTTCGGCGGCTTCGCGGTTCTCGGGGTTAACCTGTGTAATATCTCTATCCCGGCGCTGCTGGTCTATTACCTGTTCCGTAACTCCCTGCGTCCTGGGCTGAGTCAGGGGCGTCTGGTTTATCTCGGGGTAATGGCCGGGGTTCTCGGTACGCTGGGTACGGTGTGTCTGACCTCGCTGGCACTGGTGCTCGACAGCGGTAAGTCTTATATCGATCTGGTCTGGCTGCTGTTCATCGGACACCTGCCGATTTTTGTCACCGACTCCCTGATCAGTGTGGGGATCCTGCTGGCGCTGGCCAAAATGCGTCCGGCTTCCCTGATGGTCAATCAGCCCGGACAGCATACCTATGGATAAATGGCTGCCCCCTCACCGGCGCCTGCTTCTTGCTGTTCTCTGGGCTTTTC