Homologs in group_3608

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20100 FBDBKF_20100 100.0 Morganella morganii S1 icd NADP-dependent isocitrate dehydrogenase
NLDBIP_19495 NLDBIP_19495 100.0 Morganella morganii S4 icd NADP-dependent isocitrate dehydrogenase
LHKJJB_19455 LHKJJB_19455 100.0 Morganella morganii S3 icd NADP-dependent isocitrate dehydrogenase
HKOGLL_19375 HKOGLL_19375 100.0 Morganella morganii S5 icd NADP-dependent isocitrate dehydrogenase

Distribution of the homologs in the orthogroup group_3608

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3608

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08200 5.72e-24 94 90 0 50 1 icd Isocitrate dehydrogenase [NADP] Escherichia coli (strain K12)
Q02NB5 9e-21 85 80 0 50 1 icd Isocitrate dehydrogenase [NADP] Pseudomonas aeruginosa (strain UCBPP-PA14)
A0A5A4WIX0 1.46e-17 76 72 0 50 1 13AIDH-D Isocitrate dehydrogenase [NADP] 1 Psychrobacter sp. (strain 13A)
P41560 2.65e-17 75 72 1 50 1 icdI Isocitrate dehydrogenase [NADP] 1 Colwellia maris
Q9ZH99 6.53e-17 75 68 0 50 1 icd Isocitrate dehydrogenase [NADP] Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P39126 4.8e-16 72 64 0 50 1 icd Isocitrate dehydrogenase [NADP] Bacillus subtilis (strain 168)
P56063 1.45e-15 71 66 0 50 3 icd Isocitrate dehydrogenase [NADP] Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZN36 1.6e-15 70 66 0 50 3 icd Isocitrate dehydrogenase [NADP] Helicobacter pylori (strain J99 / ATCC 700824)
P50214 1.34e-13 65 66 1 50 1 icd Isocitrate dehydrogenase [NADP] Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P80046 1.89e-12 62 62 1 51 1 icd Isocitrate dehydrogenase [NADP] Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8CNX4 2.56e-11 59 54 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNL1 2.56e-11 59 54 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P99167 1.98e-10 56 52 0 50 1 icd Isocitrate dehydrogenase [NADP] Staphylococcus aureus (strain N315)
P65099 1.98e-10 56 52 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HF79 1.98e-10 56 52 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus aureus (strain COL)
Q6GG12 2.12e-10 56 52 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus aureus (strain MRSA252)
Q8NW61 2.25e-10 56 52 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus aureus (strain MW2)
Q6G8N2 2.25e-10 56 52 0 50 3 icd Isocitrate dehydrogenase [NADP] Staphylococcus aureus (strain MSSA476)
D4GU92 4.65e-06 44 40 0 50 1 icd Isocitrate dehydrogenase [NADP] Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O29610 0.000182 39 36 1 50 1 icd Isocitrate dehydrogenase [NADP] Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19365
Feature type CDS
Gene icd
Product NADP-dependent isocitrate dehydrogenase
Location 7385 - 7537 (strand: -1)
Length 153 (nucleotides) / 50 (amino acids)
In genomic island -

Contig

Accession ZDB_244
Length 12946 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3608
Orthogroup size 5
N. genomes 5

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0538 Energy production and conversion (C) C Isocitrate dehydrogenase

Protein Sequence

MGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM

Flanking regions ( +/- flanking 50bp)

TAATAAAATTATGTAGTTATATTGATTCTTAGTATCTACTGCTGCGCCACATGGGCTGGTTTGAAGCCGCTGACTTAATCGTTAAAGGAATGGAAGGGGCAATCGCTGCCAAGACCGTCACTTACGATTTCGAACGTCTGATGGAAGGTGCTAAGCTCCTGAAATGCTCAGAGTTTGGTGACGCAATCATCAAACACATGTAATTAAGTTTACAGTGAAATAATTAACGGGAACTTATTAGTTCCCGTTTTTT