Homologs in group_2141

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15830 FBDBKF_15830 100.0 Morganella morganii S1 cyoC cytochrome o ubiquinol oxidase subunit III
NLDBIP_17265 NLDBIP_17265 100.0 Morganella morganii S4 cyoC cytochrome o ubiquinol oxidase subunit III
LHKJJB_17395 LHKJJB_17395 100.0 Morganella morganii S3 cyoC cytochrome o ubiquinol oxidase subunit III
HKOGLL_17000 HKOGLL_17000 100.0 Morganella morganii S5 cyoC cytochrome o ubiquinol oxidase subunit III
F4V73_RS16480 F4V73_RS16480 94.1 Morganella psychrotolerans - cytochrome o ubiquinol oxidase subunit III
PMI_RS00510 PMI_RS00510 81.3 Proteus mirabilis HI4320 - cytochrome o ubiquinol oxidase subunit III

Distribution of the homologs in the orthogroup group_2141

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2141

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABJ5 5.68e-101 293 69 0 204 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Shigella flexneri
P0ABJ3 5.68e-101 293 69 0 204 1 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Escherichia coli (strain K12)
P0ABJ4 5.68e-101 293 69 0 204 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9I425 8.62e-85 252 60 3 209 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9WWR3 7.84e-84 249 67 0 184 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Pseudomonas putida
P57542 4.78e-56 179 48 2 201 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q03439 2.64e-54 175 46 0 181 1 ctaE Cytochrome c oxidase subunit 3 Bacillus sp. (strain PS3)
P34958 3.27e-51 167 44 1 198 1 qoxC Quinol oxidase subunit 3 Bacillus subtilis (strain 168)
E0TW65 4.58e-51 166 44 1 198 1 qoxC Quinol oxidase subunit 3 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
Q89AA5 6.1e-50 163 50 0 180 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K995 2.86e-48 159 45 0 180 3 cyoC Cytochrome bo(3) ubiquinol oxidase subunit 3 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P24012 8.18e-48 158 44 1 182 3 ctaE Cytochrome c oxidase subunit 3 Bacillus subtilis (strain 168)
Q7A183 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain MW2)
Q6GAF4 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain MSSA476)
Q6GI25 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain MRSA252)
Q7A6A0 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain N315)
Q99V38 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH25 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain COL)
Q2YX16 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZK1 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FI19 1.33e-47 157 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus aureus (strain USA300)
Q04442 1.28e-46 155 42 1 182 3 ctaE Cytochrome c oxidase subunit 3 Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q4L563 6.54e-46 153 41 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus haemolyticus (strain JCSC1435)
Q8CPP8 1.28e-45 152 40 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQB1 1.28e-45 152 40 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49WI2 2.45e-44 149 40 2 198 3 qoxC Probable quinol oxidase subunit 3 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P9WP67 1.62e-27 106 36 1 172 1 ctaE Probable cytochrome c oxidase subunit 3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP66 1.62e-27 106 36 1 172 3 ctaE Probable cytochrome c oxidase subunit 3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63857 1.62e-27 106 36 1 172 3 ctaE Probable cytochrome c oxidase subunit 3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9X809 7.84e-27 104 31 5 207 3 ctaE Probable cytochrome c oxidase subunit 3 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5YZ19 3.18e-26 102 34 1 172 3 ctaE Probable cytochrome c oxidase subunit 3 Nocardia farcinica (strain IFM 10152)
O69582 8.19e-26 102 36 3 173 3 ctaE Probable cytochrome c oxidase subunit 3 Mycobacterium leprae (strain TN)
Q73YM3 2.65e-25 100 34 1 172 3 ctaE Probable cytochrome c oxidase subunit 3 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q82AK5 4.65e-25 100 31 6 207 3 ctaE Probable cytochrome c oxidase subunit 3 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9AEL8 5.88e-24 97 33 2 174 1 ctaE Cytochrome c oxidase subunit 3 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6NGA0 1.07e-23 96 32 1 174 3 ctaE Cytochrome c oxidase subunit 3 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q8FNQ9 2.44e-23 95 31 2 174 3 ctaE Cytochrome c oxidase subunit 3 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P50677 4.35e-21 89 29 2 184 3 ctaE Cytochrome c oxidase subunit 3 Thermostichus vulcanus
Q06475 5.84e-20 87 30 4 200 3 ctaE Cytochrome c oxidase subunit 3 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P98005 5.08e-16 79 29 3 194 1 caaA Cytochrome c oxidase polypeptide I+III Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q92J29 1.33e-13 70 31 4 159 3 ctaE Probable cytochrome c oxidase subunit 3 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O47694 2.46e-12 67 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Damaliscus lunatus
P68089 4.02e-12 66 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Nanger soemmerringii
P68088 4.02e-12 66 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Nanger granti
O48374 4.02e-12 66 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Nanger dama
Q9ZZY5 4.1e-12 66 27 9 223 3 MT-CO3 Cytochrome c oxidase subunit 3 Hippopotamus amphibius
P24989 6.62e-12 65 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Balaenoptera physalus
P14575 6.66e-12 66 29 8 203 1 cox3 Cytochrome c oxidase subunit 3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O47706 6.96e-12 65 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Eudorcas thomsonii
O47705 7.24e-12 65 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Eudorcas rufifrons
O47691 7.46e-12 65 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Aepyceros melampus
O47710 1.01e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella saudiya
P68300 1.04e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella spekei
P68299 1.04e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella dorcas
P41295 1.05e-11 65 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Balaenoptera musculus
P68532 1.1e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella gazella
P68531 1.1e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella bennettii
O47700 1.11e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Litocranius walleri
O47693 1.25e-11 65 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Cephalophorus natalensis
Q35826 1.28e-11 63 28 2 146 2 COIII Cytochrome c oxidase subunit 3 (Fragment) Spodoptera frugiperda
O03170 1.32e-11 65 29 3 150 3 MT-CO3 Cytochrome c oxidase subunit 3 Latimeria chalumnae
Q4UKK0 1.33e-11 65 28 2 157 3 ctaE Probable cytochrome c oxidase subunit 3 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
O48316 1.45e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella subgutturosa
O47709 1.53e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella leptoceros
O47708 1.57e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Gazella cuvieri
O47692 1.62e-11 65 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Pelea capreolus
O47702 1.67e-11 64 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Antilope cervicapra
Q1RHH9 2.04e-11 64 30 5 161 3 ctaE Probable cytochrome c oxidase subunit 3 Rickettsia bellii (strain RML369-C)
O47701 2.18e-11 64 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Antidorcas marsupialis
O47697 2.29e-11 64 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Raphicerus melanotis
O47699 2.36e-11 64 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Madoqua guentheri
O47685 2.39e-11 64 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Tragelaphus imberbis
O47696 2.48e-11 64 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Raphicerus campestris
O47698 2.94e-11 64 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Neotragus moschatus
O47695 3e-11 64 27 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Ourebia ourebi
Q5Y4Q4 3.52e-11 63 26 9 224 3 MT-CO3 Cytochrome c oxidase subunit 3 Bos mutus grunniens
Q9ZDX3 6.19e-11 63 28 3 160 3 ctaE Probable cytochrome c oxidase subunit 3 Rickettsia prowazekii (strain Madrid E)
O47686 6.96e-11 63 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Tragelaphus oryx
P06030 7.16e-11 63 25 7 190 1 ctaE Cytochrome c oxidase subunit 3 Paracoccus denitrificans
O47687 7.31e-11 63 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Tragelaphus scriptus
O47689 7.53e-11 63 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Tragelaphus strepsiceros
Q576B8 9.46e-11 62 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Bos indicus
O47690 1.09e-10 62 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Syncerus caffer
P00415 1.25e-10 62 26 9 225 1 MT-CO3 Cytochrome c oxidase subunit 3 Bos taurus
Q35539 1.3e-10 62 25 6 200 3 MT-CO3 Cytochrome c oxidase subunit 3 Petromyzon marinus
O21619 1.64e-10 62 27 8 203 1 MT-CO3 Cytochrome c oxidase subunit 3 Ovis aries
O47688 2.06e-10 62 26 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Tragelaphus spekii
Q36455 2.56e-10 61 30 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Ornithorhynchus anatinus
P05505 2.59e-10 61 30 6 159 1 Mt-co3 Cytochrome c oxidase subunit 3 Rattus norvegicus
Q9T9Y6 3.61e-10 61 32 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Gorilla gorilla gorilla
P00416 3.65e-10 61 28 4 156 1 mt-Co3 Cytochrome c oxidase subunit 3 Mus musculus
Q95707 3.95e-10 60 32 6 154 3 MT-CO3 Cytochrome c oxidase subunit 3 Hylobates lar
P00417 4.75e-10 60 27 2 155 3 mt:CoIII Cytochrome c oxidase subunit 3 Drosophila melanogaster
Q9T9W8 5.2e-10 60 32 6 154 3 MT-CO3 Cytochrome c oxidase subunit 3 Pan paniscus
Q9T9V9 5.46e-10 60 32 6 154 3 MT-CO3 Cytochrome c oxidase subunit 3 Pan troglodytes
Q38PR6 7.48e-10 60 26 9 223 3 MT-CO3 Cytochrome c oxidase subunit 3 Mammuthus primigenius
P41312 9.3e-10 60 32 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Didelphis virginiana
Q8W9G7 1.09e-09 59 32 7 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Tachyglossus aculeatus aculeatus
P00414 1.13e-09 59 32 6 154 1 MT-CO3 Cytochrome c oxidase subunit 3 Homo sapiens
P12702 1.14e-09 59 28 4 158 3 COIII Cytochrome c oxidase subunit 3 Paracentrotus lividus
P92665 1.14e-09 59 30 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Osphranter robustus
Q2I3G8 1.53e-09 59 25 7 222 3 MT-CO3 Cytochrome c oxidase subunit 3 Elephas maximus
Q9YDX6 1.66e-09 60 22 3 184 3 aoxB Heme-copper oxidase subunit I+III Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
B0FWD1 1.68e-09 59 28 2 154 3 mt:CoIII Cytochrome c oxidase subunit 3 Aedes aegypti
Q2I3F5 1.75e-09 59 26 8 203 3 MT-CO3 Cytochrome c oxidase subunit 3 Loxodonta africana
O21403 2.17e-09 58 28 4 156 3 MT-CO3 Cytochrome c oxidase subunit 3 Struthio camelus
Q8W9N0 2.37e-09 58 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Dugong dugon
P15546 2.7e-09 58 29 4 155 3 COIII Cytochrome c oxidase subunit 3 Strongylocentrotus purpuratus
Q8SEW8 2.94e-09 58 27 2 152 3 MT-CO3 Cytochrome c oxidase subunit 3 Coturnix japonica
Q9ZXX8 3e-09 58 31 6 161 3 MT-CO3 Cytochrome c oxidase subunit 3 Papio hamadryas
P18945 4.22e-09 58 26 2 152 3 MT-CO3 Cytochrome c oxidase subunit 3 Gallus gallus
P34842 5.22e-09 57 26 2 155 3 COIII Cytochrome c oxidase subunit 3 Anopheles gambiae
P00418 6.1e-09 57 25 2 155 3 mt:CoIII Cytochrome c oxidase subunit 3 Drosophila yakuba
P80441 7.05e-09 57 29 7 201 3 COX3 Cytochrome c oxidase subunit 3 Rhizopus stolonifer
P15952 7.29e-09 57 28 4 156 2 mt-co3 Cytochrome c oxidase subunit 3 Cyprinus carpio
P39481 7.31e-09 58 33 5 140 3 soxM Quinol oxidase subunit 1/3 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q34214 7.46e-09 57 26 5 184 3 COX3 Cytochrome c oxidase subunit 3 Candida parapsilosis
Q00529 7.58e-09 57 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Phoca vitulina
Q96065 7.95e-09 57 28 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Rhinoceros unicornis
O99822 8.04e-09 57 29 5 155 3 COIII Cytochrome c oxidase subunit 3 Rhipicephalus sanguineus
O79552 1.02e-08 57 25 5 196 3 MT-CO3 Cytochrome c oxidase subunit 3 Lycodon semicarinatus
Q4JQI1 1.04e-08 57 30 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Tetraodon nigroviridis
O03201 1.11e-08 57 28 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Ceratotherium simum
Q35916 1.2e-08 57 25 6 200 1 MT-CO3 Cytochrome c oxidase subunit 3 Sus scrofa
P48892 1.28e-08 56 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Felis catus
P38597 1.44e-08 56 27 9 225 3 MT-CO3 Cytochrome c oxidase subunit 3 Halichoerus grypus
P14574 1.58e-08 56 27 4 158 3 COIII Cytochrome c oxidase subunit 3 Locusta migratoria
P48891 1.6e-08 56 27 4 159 3 COIII Cytochrome c oxidase subunit 3 Albinaria caerulea
P92481 1.73e-08 56 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Equus asinus
P48661 2e-08 56 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Equus caballus
O21331 2.2e-08 56 28 4 156 3 MT-CO3 Cytochrome c oxidase subunit 3 Dasypus novemcinctus
Q96133 2.34e-08 55 27 4 156 2 mt-co3 Cytochrome c oxidase subunit 3 Carassius auratus
O79676 2.43e-08 55 24 6 200 3 MT-CO3 Cytochrome c oxidase subunit 3 Pelomedusa subrufa
P33508 2.54e-08 55 26 2 155 3 COIII Cytochrome c oxidase subunit 3 Anopheles quadrimaculatus
P48872 4.49e-08 55 27 4 158 3 COX3 Cytochrome c oxidase subunit 3 Chondrus crispus
O79433 4.51e-08 55 28 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Oryctolagus cuniculus
Q9MIY4 6.33e-08 54 28 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Danio rerio
Q9ZZ61 7.6e-08 54 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Canis lupus familiaris
Q1HK97 8.06e-08 54 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Canis lupus
Q9ZZ48 9.04e-08 54 28 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Squalus acanthias
P34198 1.18e-07 53 26 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Formosania lacustris
Q9B1P9 1.24e-07 53 27 5 184 3 COX3A Cytochrome c oxidase subunit 3 Candida albicans (strain SC5314 / ATCC MYA-2876)
P69218 2.05e-07 53 28 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Oncorhynchus nerka
P69217 2.05e-07 53 28 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Oncorhynchus masou
P20684 2.05e-07 53 28 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Oncorhynchus clarkii
P92696 2.46e-07 53 29 4 151 3 MT-CO3 Cytochrome c oxidase subunit 3 Pongo abelii
P00419 3.77e-07 52 28 5 156 3 mt-co3 Cytochrome c oxidase subunit 3 Xenopus laevis
O79407 4.01e-07 52 27 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Scyliorhinus canicula
Q36860 5.2e-07 52 28 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Salmo salar
P92514 5.73e-07 52 29 3 151 2 COX3 Cytochrome c oxidase subunit 3 Arabidopsis thaliana
Q9T9X6 5.89e-07 52 29 4 151 3 MT-CO3 Cytochrome c oxidase subunit 3 Pongo pygmaeus
Q8LX26 7.22e-07 51 29 6 159 3 MT-CO3 Cytochrome c oxidase subunit 3 Lemur catta
Q33824 8.04e-07 51 27 4 155 3 COIII Cytochrome c oxidase subunit 3 Patiria pectinifera
P48172 8.08e-07 51 27 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Oncorhynchus mykiss
Q34943 9.32e-07 51 25 2 152 3 COIII Cytochrome c oxidase subunit 3 Lumbricus terrestris
Q37620 1.09e-06 51 29 8 161 3 COX3 Cytochrome c oxidase subunit 3 Prototheca wickerhamii
P69215 1.1e-06 51 25 2 152 3 COIII Cytochrome c oxidase subunit 3 Branchiostoma lanceolatum
P69216 1.1e-06 51 25 2 152 3 COIII Cytochrome c oxidase subunit 3 Branchiostoma floridae
Q36309 1.13e-06 51 28 2 142 3 COIII Cytochrome c oxidase subunit 3 Artemia franciscana
P55777 1.13e-06 51 27 4 156 3 mt-co3 Cytochrome c oxidase subunit 3 Gadus morhua
P14058 2.14e-06 50 27 6 179 3 COIII Cytochrome c oxidase subunit 3 Schizophyllum commune
O47491 2.78e-06 50 25 2 155 3 COIII Cytochrome c oxidase subunit 3 Metridium senile
P15953 2.98e-06 50 27 3 151 2 COX3 Cytochrome c oxidase subunit 3 Triticum aestivum
Q95914 3.04e-06 50 26 4 151 3 mt-co3 Cytochrome c oxidase subunit 3 Polypterus ornatipinnis
P48873 3.32e-06 49 23 4 188 3 COX3 Cytochrome c oxidase subunit 3 Cyanidium caldarium
P41775 3.57e-06 49 27 4 151 3 COIII Cytochrome c oxidase subunit 3 Mytilus edulis
P25003 1.11e-05 48 26 4 158 3 COIII Cytochrome c oxidase subunit 3 Pisaster ochraceus
P14853 1.48e-05 47 33 2 95 2 COX3 Cytochrome c oxidase subunit 3 Glycine max
P34843 3.29e-05 47 25 2 146 3 COIII Cytochrome c oxidase subunit 3 Apis mellifera ligustica
O47475 4.2e-05 46 24 1 137 3 COIII Cytochrome c oxidase subunit 3 Heterololigo bleekeri
P00422 4.24e-05 46 25 4 186 1 cox-3 Cytochrome c oxidase subunit 3 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q95840 6.11e-05 46 26 6 188 3 COX3 Cytochrome c oxidase subunit 3 Pyricularia grisea
Q37355 6.31e-05 46 27 1 92 3 COIII Cytochrome c oxidase subunit 3 Trypanoplasma borreli
A9RAG9 9.87e-05 45 27 5 184 3 COX3 Cytochrome c oxidase subunit 3 Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q37600 0.000131 45 27 1 132 3 COX3 Cytochrome c oxidase subunit 3 Pylaiella littoralis
P26858 0.000134 45 34 2 94 3 COX3 Cytochrome c oxidase subunit 3 Marchantia polymorpha
P14852 0.000195 44 27 3 151 3 COX3 Cytochrome c oxidase subunit 3 Oryza sativa subsp. indica
P80439 0.000251 44 24 4 197 3 COX3 Cytochrome c oxidase subunit 3 Allomyces macrogynus
Q37374 0.000621 43 30 3 106 3 COX3 Cytochrome c oxidase subunit 3 Acanthamoeba castellanii
Q36952 0.000847 42 29 1 98 3 COX3 Cytochrome c oxidase subunit 3 Aegilops columnaris
O21049 0.000871 43 28 3 124 3 cox3 Cytochrome c oxidase subunit 3 Dictyostelium discoideum
Q0H8X4 0.001 42 31 0 82 3 COX3 Cytochrome c oxidase subunit 3 Ustilago maydis (strain 521 / FGSC 9021)
P08745 0.001 42 30 1 94 3 COX3 Cytochrome c oxidase subunit 3 Oenothera berteroana

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18430
Feature type CDS
Gene cyoC
Product cytochrome o ubiquinol oxidase subunit III
Location 2665 - 3279 (strand: -1)
Length 615 (nucleotides) / 204 (amino acids)
In genomic island -

Contig

Accession ZDB_237
Length 30268 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2141
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00510 Cytochrome c oxidase subunit III

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1845 Energy production and conversion (C) C Heme/copper-type cytochrome/quinol oxidase, subunit 3

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02299 cytochrome o ubiquinol oxidase subunit III Oxidative phosphorylation
Metabolic pathways
Cytochrome o ubiquinol oxidase

Protein Sequence

MSTNTLTQHNNAHDNHGHHDAGATKVFGFWVYLMSDLILFASLFAIYVVLKDGTAGGPTGKEIFNLQFVLVETFLLLFSSITYGFAMLAMNRNQVGQVNLWLFVTFLFGLGFVAMEIYEFHELISEGYGPDHSGFLSGFFTLVATHGLHVTAGLIWIIIMIIQTSRRGLTEVNKTRLNCLSLFWHFLDVVWICVFTVVYLLGAL

Flanking regions ( +/- flanking 50bp)

AAAAATCGAAAACGCCCACTACGAACAACTGAGCAAGGCAGGTGTGGATAATGTCAACTAATACCCTGACTCAACATAATAACGCCCATGATAATCATGGGCATCACGATGCAGGTGCGACCAAGGTCTTCGGATTCTGGGTCTACCTGATGAGTGACCTGATTCTGTTTGCGAGTCTGTTCGCCATTTATGTGGTGCTGAAAGACGGCACCGCCGGCGGCCCGACCGGCAAAGAGATCTTTAACTTACAGTTTGTACTGGTGGAAACCTTCCTGCTGTTATTCAGCAGTATCACCTACGGCTTTGCCATGCTGGCAATGAACCGCAATCAGGTGGGTCAGGTTAATCTGTGGTTATTTGTGACTTTCCTGTTCGGCCTCGGCTTCGTAGCGATGGAAATCTATGAATTCCATGAATTAATCAGCGAAGGTTACGGCCCTGACCACAGCGGCTTCCTGTCCGGTTTCTTCACCCTGGTGGCAACACACGGTCTTCACGTCACAGCCGGTCTTATCTGGATCATCATCATGATCATCCAGACCAGCCGCCGCGGCCTGACCGAAGTGAATAAAACCCGCCTGAACTGCTTAAGCCTGTTCTGGCACTTCCTGGACGTGGTCTGGATTTGTGTGTTCACCGTTGTTTATCTGTTGGGGGCACTGTAATGAGTCATTCAAATACAGCCGGTACCGGGGCAAGCCACGGTAGTGTGAAA