Homologs in group_2102

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15825 FBDBKF_15825 100.0 Morganella morganii S1 cyoD cytochrome o ubiquinol oxidase subunit IV
NLDBIP_17260 NLDBIP_17260 100.0 Morganella morganii S4 cyoD cytochrome o ubiquinol oxidase subunit IV
LHKJJB_17400 LHKJJB_17400 100.0 Morganella morganii S3 cyoD cytochrome o ubiquinol oxidase subunit IV
HKOGLL_16995 HKOGLL_16995 100.0 Morganella morganii S5 cyoD cytochrome o ubiquinol oxidase subunit IV
F4V73_RS16485 F4V73_RS16485 93.6 Morganella psychrotolerans - cytochrome o ubiquinol oxidase subunit IV
PMI_RS00505 PMI_RS00505 82.7 Proteus mirabilis HI4320 - cytochrome o ubiquinol oxidase subunit IV

Distribution of the homologs in the orthogroup group_2102

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2102

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABJ8 2.87e-48 152 70 1 108 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Shigella flexneri
P0ABJ6 2.87e-48 152 70 1 108 1 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Escherichia coli (strain K12)
P0ABJ7 2.87e-48 152 70 1 108 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Escherichia coli O157:H7
Q9I424 6.25e-27 98 51 0 108 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9WWR4 5.95e-26 96 42 0 110 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Pseudomonas putida
Q8K996 1.19e-15 69 40 0 88 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57541 9.46e-15 67 46 0 96 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AA6 1.52e-10 56 33 0 77 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7A184 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain MW2)
Q6GAF5 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain MSSA476)
Q7A6A1 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain N315)
Q99V39 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH26 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain COL)
Q2YX17 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZK2 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FI20 0.00031 40 26 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain USA300)
Q6GI26 0.000472 39 25 0 86 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain MRSA252)
Q49WI1 0.000602 39 25 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P34959 0.0009 39 28 0 82 1 qoxD Quinol oxidase subunit 4 Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18425
Feature type CDS
Gene cyoD
Product cytochrome o ubiquinol oxidase subunit IV
Location 2333 - 2665 (strand: -1)
Length 333 (nucleotides) / 110 (amino acids)

Contig

Accession ZDB_237
Length 30268 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2102
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03626 Prokaryotic Cytochrome C oxidase subunit IV

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3125 Energy production and conversion (C) C Heme/copper-type cytochrome/quinol oxidase, subunit 4

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02300 cytochrome o ubiquinol oxidase subunit IV Oxidative phosphorylation
Metabolic pathways
Cytochrome o ubiquinol oxidase

Protein Sequence

MSHSNTAGTGASHGSVKTYLIGFILSVILTVIPFYMVIEGTASTSVLLATVVITAVVQILVHLVCFLHMNTASEERWNLIAFLFTLLIIGIVVVGSLWIMYNLNINMMVD

Flanking regions ( +/- flanking 50bp)

GTGGTCTGGATTTGTGTGTTCACCGTTGTTTATCTGTTGGGGGCACTGTAATGAGTCATTCAAATACAGCCGGTACCGGGGCAAGCCACGGTAGTGTGAAAACCTATCTGATCGGCTTTATATTGTCGGTCATTCTGACAGTCATCCCGTTTTATATGGTGATTGAGGGAACCGCCTCAACATCTGTTCTGCTGGCGACTGTTGTGATTACTGCTGTTGTTCAGATTCTTGTTCACCTGGTGTGCTTCCTGCACATGAATACCGCGTCTGAAGAGCGCTGGAACCTGATTGCGTTCCTGTTCACGCTCCTCATTATCGGTATCGTGGTCGTGGGTTCACTGTGGATTATGTACAACCTGAACATCAATATGATGGTTGATTAAGAGTTGCCGATATGATGAAGCAATACCTGCAAGTGACCAAACCGGGAATT