Homologs in group_3338

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11245 FBDBKF_11245 100.0 Morganella morganii S1 - Cro/Cl family transcriptional regulator
NLDBIP_05300 NLDBIP_05300 100.0 Morganella morganii S4 - Cro/Cl family transcriptional regulator
LHKJJB_02180 LHKJJB_02180 100.0 Morganella morganii S3 - Cro/Cl family transcriptional regulator
HKOGLL_15560 HKOGLL_15560 100.0 Morganella morganii S5 - Cro/Cl family transcriptional regulator

Distribution of the homologs in the orthogroup group_3338

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3338

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17970
Feature type CDS
Gene -
Product Cro/Cl family transcriptional regulator
Location 35637 - 35864 (strand: -1)
Length 228 (nucleotides) / 75 (amino acids)

Contig

Accession ZDB_234
Length 41502 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3338
Orthogroup size 5
N. genomes 5

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4197 Transcription (K) K DNA-binding transcriptional regulator YdaS, prophage-encoded, Cro superfamily

Protein Sequence

MEQLRIFLNALSVSEQESFAKKCGTTIGYLRKAISKGTKLGTELCVLIEKNSNSVVKRQHLYPEDWEKNWPELAA

Flanking regions ( +/- flanking 50bp)

GTATACCTACGGGTATATTTATCTCACGCATAGGTAAACAAGGACAACGCATGGAACAATTACGGATTTTCCTAAATGCGCTCTCAGTATCAGAACAAGAGTCTTTCGCAAAAAAATGCGGAACAACTATCGGATACCTGAGAAAGGCAATCTCAAAGGGCACAAAACTCGGCACAGAGTTATGTGTGCTCATTGAAAAAAACAGCAACTCAGTGGTTAAGCGCCAGCATTTATATCCAGAAGATTGGGAAAAAAACTGGCCTGAACTTGCCGCATAAGACAACCAAAAATCAGTAGCTGAACGGCACAGCATATTGTCGGGCGGGCG