Homologs in group_3081

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18855 FBDBKF_18855 100.0 Morganella morganii S1 cbiM energy-coupling factor ABC transporter permease
NLDBIP_18430 NLDBIP_18430 100.0 Morganella morganii S4 cbiM energy-coupling factor ABC transporter permease
LHKJJB_09195 LHKJJB_09195 100.0 Morganella morganii S3 cbiM energy-coupling factor ABC transporter permease
HKOGLL_08745 HKOGLL_08745 100.0 Morganella morganii S5 cbiM energy-coupling factor ABC transporter permease
F4V73_RS13740 F4V73_RS13740 97.1 Morganella psychrotolerans - energy-coupling factor ABC transporter permease

Distribution of the homologs in the orthogroup group_3081

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3081

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q05594 1.91e-130 371 74 0 238 1 cbiM Cobalt transport protein CbiM Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D3UMA1 6.87e-103 301 64 2 234 3 cbiM Cobalt transport protein CbiM Listeria seeligeri serovar 1/2b (strain ATCC 35967 / DSM 20751 / CCM 3970 / CCUG 15530 / CIP 100100 / LMG 11386 / NCTC 11856 / SLCC 3954 / 1120)
C9YID6 8.89e-91 271 60 1 223 3 cbiM Cobalt transport protein CbiM Clostridioides difficile (strain R20291)
A3CL70 1.11e-90 270 59 1 225 3 cbiM Cobalt transport protein CbiM Streptococcus sanguinis (strain SK36)
A5VM74 8.37e-87 260 55 2 236 3 cbiM Cobalt transport protein CbiM Limosilactobacillus reuteri (strain DSM 20016)
B3EC54 3.49e-81 246 58 1 219 3 cbiM Cobalt transport protein CbiM Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
E3PSD4 6.73e-81 245 55 1 226 3 cbiM Cobalt transport protein CbiM Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
B7GLU2 4.44e-80 243 55 2 234 3 cbiM Cobalt transport protein CbiM Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A6LKX5 4.59e-79 240 54 2 220 3 cbiM Cobalt transport protein CbiM Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q3AE25 4.68e-79 241 58 1 214 3 cbiM Cobalt transport protein CbiM Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
D5AUZ9 3.73e-77 235 57 0 215 1 cbiM Cobalt transport protein CbiM Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q897L1 1.29e-76 234 50 4 235 3 cbiM Cobalt transport protein CbiM Clostridium tetani (strain Massachusetts / E88)
Q2RJ53 1.74e-75 232 56 0 210 3 cbiM Cobalt transport protein CbiM Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B8I0P7 3.45e-75 231 50 1 222 3 cbiM Cobalt transport protein CbiM Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
D9SNZ5 8.81e-75 230 51 0 211 3 cbiM Cobalt transport protein CbiM Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B)
D9S0S1 2.99e-74 228 52 0 218 3 cbiM Cobalt transport protein CbiM Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
A5UQS9 3.36e-74 228 55 2 218 3 cbiM Cobalt transport protein CbiM Roseiflexus sp. (strain RS-1)
D5WSC8 7.14e-74 228 53 1 229 3 cbiM Cobalt transport protein CbiM Kyrpidia tusciae (strain DSM 2912 / NBRC 15312 / T2)
A9KP98 1.59e-73 227 51 1 228 3 cbiM Cobalt transport protein CbiM Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
D9QVP6 3.49e-73 226 53 2 219 3 cbiM Cobalt transport protein CbiM Acetohalobium arabaticum (strain ATCC 49924 / DSM 5501 / Z-7288)
A4J832 3.53e-73 226 56 1 210 3 cbiM Cobalt transport protein CbiM Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
D1AFI6 5.89e-73 225 53 1 213 3 cbiM Cobalt transport protein CbiM Sebaldella termitidis (strain ATCC 33386 / NCTC 11300)
Q8DG81 8.94e-73 225 52 0 217 3 cbiM Cobalt transport protein CbiM Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
O54190 2.63e-72 223 57 0 208 3 cbiM Cobalt transport protein CbiM Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2NHA4 4.7e-72 222 49 2 221 3 cbiM Putative cobalt transport protein CbiM Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
B8GEB7 1.2e-71 221 53 0 206 3 cbiM2 Putative cobalt transport protein CbiM 2 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
A1ANE2 1.61e-71 221 54 0 208 3 cbiM2 Cobalt transport protein CbiM 2 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A1ANC7 2.07e-71 221 54 0 208 3 cbim1 Cobalt transport protein CbiM 1 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
O29530 7.43e-71 219 52 3 219 3 cbiM Putative cobalt transport protein CbiM Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8YQ91 9.86e-69 215 59 0 211 3 cbiM Cobalt transport protein CbiM Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q58491 1.48e-68 213 52 1 206 3 cbiM Putative cobalt transport protein CbiM Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
B8GJG9 1.54e-67 211 49 1 215 3 cbiM1 Putative cobalt transport protein CbiM 1 Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
D7DR00 2.24e-66 207 52 3 209 3 cbiM Putative cobalt transport protein CbiM Methanococcus voltae (strain ATCC BAA-1334 / A3)
Q46AL8 6.91e-66 207 48 1 212 3 cbiM2 Putative cobalt transport protein CbiM 2 Methanosarcina barkeri (strain Fusaro / DSM 804)
A2SSE8 7.37e-65 204 54 3 209 3 cbiM2 Putative cobalt transport protein CbiM 2 Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
B0R611 1.3e-64 203 54 4 199 3 cbiM Putative cobalt transport protein CbiM Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q46D59 7.89e-64 201 49 0 206 3 cbiM1 Putative cobalt transport protein CbiM 1 Methanosarcina barkeri (strain Fusaro / DSM 804)
D7GIS1 1.54e-61 196 48 0 206 3 cbiM Cobalt transport protein CbiM Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / DSM 4902 / CIP 103027 / NCIMB 8099 / CIRM-BIA1)
Q18J48 2.06e-56 182 52 5 219 3 cbiM Putative cobalt transport protein CbiM Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
A2SQF0 3.46e-47 159 49 1 166 3 cbiM1 Putative cobalt transport protein CbiM 1 Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A2SSD6 2.35e-46 165 45 3 211 3 cbiMQ Putative fused cobalt transport protein CbiMQ Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q748J7 5.28e-41 146 39 4 226 3 cbiM Cobalt transport protein CbiM Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A9GQ89 5.05e-32 120 36 3 201 3 cbiM Cobalt transport protein CbiM Sorangium cellulosum (strain So ce56)
Q58964 9.19e-15 74 35 2 130 3 MJ1569 Putative metal transport protein MJ1569 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O28435 3.3e-13 70 33 4 187 3 AF_1843 Putative fused nickel transport protein NikMN Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
F9USS7 2.87e-11 65 28 1 138 2 larMN Probable fused nickel transport protein LarMN Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
D5AQY8 1.01e-09 61 31 4 157 1 nikMN Fused nickel transport protein NikMN Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q18EC4 1.15e-09 60 32 1 128 3 cbiM Putative metal transport protein HQ_3621A Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17050
Feature type CDS
Gene cbiM
Product energy-coupling factor ABC transporter permease
Location 16391 - 17125 (strand: -1)
Length 735 (nucleotides) / 244 (amino acids)

Contig

Accession ZDB_231
Length 52966 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3081
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01891 Cobalt uptake substrate-specific transmembrane region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0310 Inorganic ion transport and metabolism (P) P ABC-type Co2+ transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02007 cobalt/nickel transport system permease protein ABC transporters -

Protein Sequence

MQQKLTQFSLTGAAVTILLMIAPQEAFAMHIMEGFLPPMWAIAWWLIFLPFLGAGIVRLKAIVQEDANQKVLLALCGAFIFVLSALKIPSVTGSCSHPTGVALAVILFGPSVVAVLGSIVLLFQALLLAHGGLTTLGANGMSMAVIGPIVGYLVWRFTTKLGWRKDVCVFLVAVIADLTTYFVTSVQLGVAFPDPQMGMGAAILKFMGIFCLTQVPIAIAEGLLTVLVYDQLVKRNLVGNEVRA

Flanking regions ( +/- flanking 50bp)

TCTCAACGGTATTAATTAATAAAACCCGGAAATAATTCGGTGAGGTTGTTATGCAACAGAAACTCACGCAGTTCTCGTTAACCGGTGCCGCCGTCACAATTCTGCTGATGATTGCACCCCAGGAAGCCTTTGCCATGCATATCATGGAAGGCTTTTTACCGCCGATGTGGGCGATTGCCTGGTGGCTGATTTTCCTGCCGTTCCTCGGCGCGGGGATTGTCCGCCTTAAAGCGATTGTTCAGGAAGATGCCAACCAGAAAGTTCTGCTGGCACTGTGCGGCGCCTTTATCTTTGTGCTTTCCGCGCTGAAGATCCCGTCAGTGACCGGCAGCTGCTCTCACCCTACCGGGGTGGCGCTGGCGGTTATCCTGTTCGGGCCATCCGTGGTAGCTGTGCTCGGCTCCATCGTGCTGCTGTTCCAGGCATTGCTGCTGGCGCACGGCGGCCTGACCACCCTCGGTGCCAACGGCATGTCGATGGCGGTTATCGGACCGATTGTCGGCTATCTGGTCTGGCGTTTTACCACCAAACTGGGCTGGCGTAAGGATGTCTGCGTCTTCCTTGTCGCGGTGATAGCGGATTTAACCACCTATTTTGTCACCTCGGTGCAGCTCGGTGTCGCTTTCCCGGATCCGCAGATGGGGATGGGTGCGGCGATCCTGAAGTTCATGGGTATCTTCTGTCTGACTCAGGTACCAATTGCGATTGCGGAAGGTCTGCTGACGGTACTGGTTTATGATCAGCTGGTGAAACGTAACCTGGTGGGTAACGAGGTGCGGGCATGAAAAAGACACTGATTTTACTGTTTCTGACTGTTGCGATTTTTATCATCCCG