Homologs in group_3074

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18820 FBDBKF_18820 100.0 Morganella morganii S1 cobC alpha-ribazole phosphatase
NLDBIP_18395 NLDBIP_18395 100.0 Morganella morganii S4 cobC alpha-ribazole phosphatase
LHKJJB_09230 LHKJJB_09230 100.0 Morganella morganii S3 cobC alpha-ribazole phosphatase
HKOGLL_08780 HKOGLL_08780 100.0 Morganella morganii S5 cobC alpha-ribazole phosphatase
F4V73_RS13775 F4V73_RS13775 71.2 Morganella psychrotolerans cobC alpha-ribazole phosphatase

Distribution of the homologs in the orthogroup group_3074

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3074

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52086 1.15e-45 153 39 1 198 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Escherichia coli (strain K12)
P39701 2.69e-45 152 40 1 202 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P58652 7.41e-44 148 40 1 202 3 cobC Adenosylcobalamin/alpha-ribazole phosphatase Salmonella typhi
D3DFG8 4.77e-18 82 28 2 196 1 pspA Phosphoserine phosphatase 1 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
Q7N900 1.1e-17 80 32 4 182 3 gpmB Probable phosphoglycerate mutase GpmB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TI09 1.52e-17 80 34 4 170 3 gpmB Probable phosphoglycerate mutase GpmB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2VH13 1.54e-17 80 33 4 170 3 gpmB Probable phosphoglycerate mutase GpmB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4W6B3 1.57e-17 80 34 4 170 3 gpmB Probable phosphoglycerate mutase GpmB Enterobacter sp. (strain 638)
B5Y264 1.67e-17 80 34 4 170 3 gpmB Probable phosphoglycerate mutase GpmB Klebsiella pneumoniae (strain 342)
A7MIJ0 2.41e-17 80 32 4 170 3 gpmB Probable phosphoglycerate mutase GpmB Cronobacter sakazakii (strain ATCC BAA-894)
D3DFP8 3.09e-16 77 31 3 175 1 pspB Putative phosphoserine phosphatase 2 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
Q31SU3 3.29e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Shigella boydii serotype 4 (strain Sb227)
B2TZS8 3.29e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YTZ9 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Shigella sonnei (strain Ss046)
P0A7A4 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Shigella flexneri
Q0SX17 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Shigella flexneri serotype 5b (strain 8401)
B1LEK2 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain SMS-3-5 / SECEC)
B6I6P3 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain SE11)
B7NH70 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7A2 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain K12)
B1IS24 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A8C4 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O9:H4 (strain HS)
B1XFK5 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain K12 / DH10B)
C4ZT77 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXV9 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O8 (strain IAI1)
B5Z4S7 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7A3 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O157:H7
B7LEP1 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain 55989 / EAEC)
A7ZVT7 3.5e-16 77 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LNT7 5.35e-16 76 32 4 168 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4EY52 8.7e-16 75 34 3 169 3 gpmB Probable phosphoglycerate mutase GpmB Proteus mirabilis (strain HI4320)
Q327K0 1.72e-15 75 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Shigella dysenteriae serotype 1 (strain Sd197)
Q1R246 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain UTI89 / UPEC)
Q8FA40 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T8R6 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJW4 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O1:K1 / APEC
B7MTE3 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O81 (strain ED1a)
B7NW76 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MNK4 2.12e-15 74 31 4 169 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O45:K1 (strain S88 / ExPEC)
A1JJB8 4.01e-15 74 31 4 173 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JL20 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EU3 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQH5 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis (strain Pestoides F)
Q1CMX2 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R032 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIP0 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis
B2K3K5 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0L5 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMF8 2.43e-14 72 34 4 167 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8ALW1 4.93e-14 71 32 4 168 3 gpmB Probable phosphoglycerate mutase GpmB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8G9J4 1.15e-13 70 32 5 170 3 gpmB Probable phosphoglycerate mutase GpmB Serratia proteamaculans (strain 568)
Q57G26 2.09e-13 69 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella choleraesuis (strain SC-B67)
B5BAL1 2.29e-13 69 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain AKU_12601)
Q8ZJU8 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TU55 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella schwarzengrund (strain CVM19633)
A9N7F5 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK44 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4I9 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella newport (strain SL254)
B4TH18 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella heidelberg (strain SL476)
B5R9W3 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3B7 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella enteritidis PT4 (strain P125109)
B5FTD9 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella dublin (strain CT_02021853)
B5F543 3.48e-13 68 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella agona (strain SL483)
Q7ZVE3 5.22e-13 68 34 4 138 1 tigarb Fructose-2,6-bisphosphatase TIGAR B Danio rerio
A9MR94 5.79e-13 68 30 4 168 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z0T4 1.19e-12 67 31 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhi
A1TC01 1.42e-12 67 31 1 138 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P9WIC7 1.87e-12 67 32 3 164 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC6 1.87e-12 67 32 3 164 3 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C0Q8F5 3.26e-12 66 30 2 164 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi C (strain RKS4594)
Q21122 3.76e-12 67 28 4 164 3 pfkb-1.2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Caenorhabditis elegans
Q29RA5 3.97e-11 63 32 3 127 2 tigara Probable fructose-2,6-bisphosphatase TIGAR A Danio rerio
F4KI56 5.44e-10 60 32 7 171 1 IPSP Metal-independent phosphoserine phosphatase Arabidopsis thaliana
A5EV29 8.13e-10 60 36 2 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Dichelobacter nodosus (strain VCS1703A)
Q1JQA7 8.2e-10 60 33 4 135 2 TIGAR Fructose-2,6-bisphosphatase TIGAR Bos taurus
B1WAX6 1.08e-09 60 33 4 137 2 tigar Fructose-2,6-bisphosphatase TIGAR Xenopus tropicalis
Q4V7R0 1.42e-09 59 30 6 168 2 tigar Fructose-2,6-bisphosphatase TIGAR Xenopus laevis
Q6MWZ7 2.08e-09 58 28 6 199 1 gpm2 Acid phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8BZA9 2.33e-09 58 34 4 133 1 Tigar Fructose-2,6-bisphosphatase TIGAR Mus musculus
O07617 6.89e-09 56 35 2 105 3 phoE Uncharacterized phosphatase PhoE Bacillus subtilis (strain 168)
P32604 8.42e-09 58 28 6 167 1 FBP26 Fructose-2,6-bisphosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q16875 8.54e-09 58 26 4 173 1 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Homo sapiens
Q5R9C1 1.06e-08 57 26 4 173 2 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Pongo abelii
Q7NJF7 1.19e-08 56 29 1 131 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9FNJ9 1.32e-08 57 26 3 178 1 At5g22620 Probable 2-carboxy-D-arabinitol-1-phosphatase Arabidopsis thaliana
C4K389 1.77e-08 56 34 2 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q16877 1.99e-08 57 26 4 173 1 PFKFB4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Homo sapiens
O35552 2.09e-08 57 26 4 173 2 Pfkfb3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Rattus norvegicus
Q4R8B6 2.11e-08 57 26 4 173 2 PFKFB4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Macaca fascicularis
Q9NQ88 2.33e-08 56 32 4 135 1 TIGAR Fructose-2,6-bisphosphatase TIGAR Homo sapiens
O60825 2.4e-08 56 27 6 174 1 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Homo sapiens
Q9JJH5 2.41e-08 56 27 6 174 1 Pfkfb2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Rattus norvegicus
W5EP13 2.67e-08 56 27 2 168 1 None 2-carboxy-D-arabinitol-1-phosphatase Triticum aestivum
Q64R85 2.89e-08 55 30 4 151 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain YCH46)
Q5LAT7 2.89e-08 55 30 4 151 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q929G8 3.83e-08 55 31 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P36136 5.21e-08 55 29 7 198 1 SHB17 Sedoheptulose 1,7-bisphosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9LM13 6.1e-08 55 43 0 60 2 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Arabidopsis thaliana
Q9SCS3 6.24e-08 54 28 5 157 2 At3g50520 Phosphoglycerate mutase-like protein 4 Arabidopsis thaliana
Q01YD0 7.11e-08 54 30 5 144 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solibacter usitatus (strain Ellin6076)
Q73M14 7.71e-08 54 30 5 153 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
O94461 9.2e-08 53 26 4 164 3 SPAC1687.21 Probable phosphatase C1687.21 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P70265 9.45e-08 55 27 6 174 1 Pfkfb2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Mus musculus
Q8Y571 1.03e-07 53 30 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P25114 1.17e-07 54 26 4 173 1 Pfkfb4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Rattus norvegicus
Q71XG0 1.17e-07 53 30 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain F2365)
C1KXG0 1.17e-07 53 30 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DFA5 1.18e-07 53 30 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4a (strain HCC23)
Q9PLK4 1.27e-07 53 26 5 164 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia muridarum (strain MoPn / Nigg)
Q6DTY7 1.28e-07 54 26 4 173 2 Pfkfb4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Mus musculus
Q28901 1.3e-07 54 25 4 173 1 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) Bos taurus
B2JC95 1.31e-07 53 33 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5P7N4 1.33e-07 53 33 3 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q4L8T0 1.43e-07 53 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus haemolyticus (strain JCSC1435)
Q8KL44 1.49e-07 53 29 4 135 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P00950 1.56e-07 53 30 3 109 1 GPM1 Phosphoglycerate mutase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q2YBZ1 1.59e-07 53 34 2 94 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5NVT1 1.8e-07 54 27 6 174 2 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Pongo abelii
P64956 1.88e-07 53 28 4 198 4 BQ2027_MB2253C Uncharacterized protein Mb2253c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLH4 1.88e-07 53 28 4 198 4 MT2287 Uncharacterized protein MT2287 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WLH5 1.88e-07 53 28 4 198 1 Rv2228c Bifunctional protein Rv2228c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B7GUR7 2.35e-07 53 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
P59159 2.35e-07 53 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain NCC 2705)
B3DQI6 2.35e-07 53 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain DJO10A)
Q9URZ7 2.38e-07 53 27 5 174 3 SPAC732.02c Probable fructose-2,6-bisphosphatase C732.02c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A0AKV8 2.49e-07 52 30 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q12040 2.79e-07 52 26 5 171 1 YOR283W Broad-specificity phosphatase YOR283W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B7J2L3 3.57e-07 52 33 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ZS7)
O51602 3.57e-07 52 33 2 106 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B9DL85 3.79e-07 52 35 3 101 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus carnosus (strain TM300)
B0BAH7 3.87e-07 52 26 5 164 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q91309 3.98e-07 53 26 4 173 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Aquarana catesbeiana
Q8TN93 4.12e-07 52 43 0 62 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
F4I8M8 4.44e-07 52 41 0 60 2 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Arabidopsis thaliana
B2S2B5 5.93e-07 52 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum subsp. pallidum (strain SS14)
P96121 5.93e-07 52 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum (strain Nichols)
Q91348 6.06e-07 52 25 4 173 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Gallus gallus
B0RQR7 6.21e-07 52 32 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain B100)
Q660L2 6.35e-07 52 33 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q8P7A1 6.45e-07 52 32 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWV1 6.45e-07 52 32 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas campestris pv. campestris (strain 8004)
Q9Z743 6.45e-07 51 33 2 90 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia pneumoniae
O84727 7.49e-07 51 25 5 164 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KKX2 7.49e-07 51 25 5 164 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q0SMJ5 7.77e-07 51 33 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella afzelii (strain PKo)
Q49ZZ2 9.32e-07 51 31 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q82GB8 9.5e-07 51 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P70266 1.05e-06 52 24 4 173 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Mus musculus
Q98DM0 1.11e-06 50 28 5 138 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4JI45 1.13e-06 51 32 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A1K9B9 1.16e-06 51 32 3 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azoarcus sp. (strain BH72)
B0B8U8 1.16e-06 50 25 5 164 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q8CN61 1.19e-06 50 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P82612 1.21e-06 51 34 2 91 1 GPM1 Phosphoglycerate mutase Candida albicans (strain SC5314 / ATCC MYA-2876)
Q63XU7 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain K96243)
A3N5B0 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 668)
Q3JWH7 1.24e-06 50 31 3 107 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1710b)
A3NR09 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1106a)
A1UZX9 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain SAVP1)
Q62F43 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain ATCC 23344)
A2S625 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10229)
A3MQ23 1.24e-06 50 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10247)
P49872 1.43e-06 51 24 4 173 2 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Bos taurus
P07953 1.45e-06 51 24 4 173 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Rattus norvegicus
Q39CN6 1.45e-06 50 32 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P33158 1.59e-06 50 32 2 103 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8A765 1.61e-06 50 31 2 105 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q6FZ12 1.62e-06 50 29 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella quintana (strain Toulouse)
P16118 1.67e-06 51 24 4 173 1 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Homo sapiens
Q6MJP3 1.7e-06 50 31 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B5RQ00 2.01e-06 50 33 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia recurrentis (strain A1)
Q8L1Z7 2.06e-06 50 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A9IXE7 2.21e-06 50 28 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q5HLI0 2.31e-06 50 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9HIJ2 2.32e-06 49 38 1 84 1 Ta1347 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q0BBK5 2.45e-06 50 31 3 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A1VKR6 2.5e-06 50 32 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polaromonas naphthalenivorans (strain CJ2)
B5RMK4 2.5e-06 50 33 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia duttonii (strain Ly)
B2SX15 2.59e-06 50 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q7N6S0 2.65e-06 50 30 2 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q15SN0 3e-06 49 22 5 223 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1UTM4 3.01e-06 49 28 4 174 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A2SDN6 3.09e-06 49 31 3 115 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B1JZ61 3.33e-06 49 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia orbicola (strain MC0-3)
B4EA64 3.33e-06 49 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
C4XIQ5 3.61e-06 49 33 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B1YNA6 3.91e-06 49 31 3 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain MC40-6)
A9IFJ0 3.99e-06 49 31 4 126 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q0KET8 4.1e-06 49 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1WDX2 4.4e-06 49 32 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Verminephrobacter eiseniae (strain EF01-2)
Q2T1H5 4.6e-06 49 32 4 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B2KBU4 4.82e-06 49 27 3 129 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Elusimicrobium minutum (strain Pei191)
Q47KS8 5.03e-06 49 32 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermobifida fusca (strain YX)
B4EST0 5.06e-06 49 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Proteus mirabilis (strain HI4320)
P59161 5.2e-06 48 31 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8RFG9 5.59e-06 48 26 4 141 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1JRT1 5.73e-06 48 30 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1R083 6.8e-06 48 33 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia turicatae (strain 91E135)
Q5L4Y3 6.85e-06 48 28 5 144 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia abortus (strain DSM 27085 / S26/3)
A4SDM0 7.87e-06 48 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q256A6 8.54e-06 48 38 0 60 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia felis (strain Fe/C-56)
B2AGP7 9.39e-06 48 32 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B1GZZ1 9.89e-06 48 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Endomicrobium trichonymphae
Q821N6 1.11e-05 48 38 0 60 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q03KA9 1.27e-05 48 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q8VVB5 1.27e-05 48 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZF1 1.27e-05 48 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain CNRZ 1066)
B1JSU1 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66D83 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNS2 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis (strain Pestoides F)
Q1CFN6 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3B3 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGY5 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis
B2K8R3 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C964 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKP6 1.33e-05 48 29 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B3QVL0 1.39e-05 48 30 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q7W1Q6 1.58e-05 47 29 6 147 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B6IYD3 1.59e-05 47 26 3 144 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodospirillum centenum (strain ATCC 51521 / SW)
B4SPL6 1.59e-05 47 33 4 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Stenotrophomonas maltophilia (strain R551-3)
C1CSS1 1.62e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLZ5 1.62e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain P1031)
B2IRR1 1.62e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain CGSP14)
B8ZM52 1.62e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CFM7 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain JJA)
P0A3Y4 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A3Y3 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1I720 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Hungary19A-6)
C1C8P5 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain 70585)
B5E706 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 19F (strain G54)
Q04JB4 1.64e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q39V40 1.65e-05 47 30 3 108 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q38Z74 1.69e-05 47 29 2 105 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q6AAU8 1.72e-05 47 31 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A3CLS0 1.73e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus sanguinis (strain SK36)
B2S101 1.74e-05 47 32 2 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia hermsii (strain HS1 / DAH)
Q8KFC8 1.78e-05 47 30 2 104 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A4W369 1.8e-05 47 31 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus suis (strain 98HAH33)
B8DLN4 1.82e-05 47 33 3 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C3MBY8 2.32e-05 47 28 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B2FHH6 2.37e-05 47 33 4 106 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Stenotrophomonas maltophilia (strain K279a)
B5XM69 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD07 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48SP2 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RDV4 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5W1 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JG44 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL20 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAX0 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65711 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB88 2.41e-05 47 31 3 107 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD06 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99Z29 2.41e-05 47 31 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M1
B9DUS6 2.56e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q7VS43 2.57e-05 47 29 6 147 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQN2 2.57e-05 47 29 6 147 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5YP50 2.65e-05 47 31 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nocardia farcinica (strain IFM 10152)
A8AW46 2.74e-05 47 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q3B5J2 2.78e-05 47 29 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P36623 2.78e-05 47 28 4 132 1 gpm1 Phosphoglycerate mutase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B1VS80 3.08e-05 47 30 3 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A6UEW3 3.09e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium medicae (strain WSM419)
C5BEL3 3.1e-05 47 30 3 108 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Edwardsiella ictaluri (strain 93-146)
A5VVV5 3.24e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8E0G9 3.28e-05 46 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E643 3.28e-05 46 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1U2 3.28e-05 46 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P16290 3.29e-05 47 32 3 108 1 Pgam2 Phosphoglycerate mutase 2 Rattus norvegicus
Q8K9N1 3.54e-05 46 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6GE17 3.6e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MRSA252)
Q54NE6 3.69e-05 46 30 2 108 1 gpmA Probable phosphoglycerate mutase Dictyostelium discoideum
Q8YDC9 3.71e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMJ1 3.71e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 2 (strain ATCC 23457)
B8GFF8 4.06e-05 46 33 2 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q476J7 4.08e-05 46 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P59160 4.12e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis biovar 1 (strain 1330)
A9WW62 4.12e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MCX8 4.12e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q576R3 4.12e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus biovar 1 (strain 9-941)
Q2YJN6 4.12e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain 2308)
B2SC37 4.12e-05 46 27 6 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain S19)
Q1LTL3 4.17e-05 46 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Baumannia cicadellinicola subsp. Homalodisca coagulata
A7IC75 4.53e-05 46 27 8 217 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q74CR0 4.59e-05 46 31 3 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q6D7E3 4.7e-05 46 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P65709 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MW2)
A8YYG4 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6Q5 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain MSSA476)
P99153 4.7e-05 46 33 2 89 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain N315)
P65708 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJQ5 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Newman)
Q5HDD9 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain COL)
Q2YVZ6 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IVJ6 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain JH9)
Q2FVK8 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE81 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain USA300)
A6U4E6 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain JH1)
A7X656 4.7e-05 46 33 2 89 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q0SF09 4.85e-05 46 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus jostii (strain RHA1)
B5Y7Q7 4.88e-05 46 29 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q8A8R2 5.14e-05 46 26 7 172 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q88T35 5.33e-05 46 25 2 108 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
C1AZ61 5.59e-05 46 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus opacus (strain B4)
C0MCW5 6.3e-05 45 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U1Y5 6.3e-05 45 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8R8 6.3e-05 45 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. equi (strain 4047)
O70250 6.62e-05 45 32 3 108 1 Pgam2 Phosphoglycerate mutase 2 Mus musculus
A6WYJ2 6.73e-05 45 28 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2L0A6 6.98e-05 45 28 6 156 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella avium (strain 197N)
A1TTW5 7.71e-05 45 29 3 109 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paracidovorax citrulli (strain AAC00-1)
B5BC52 7.82e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi A (strain AKU_12601)
Q5PG75 7.82e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8ZQS2 8.04e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MTL3 8.04e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TC26 8.04e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella heidelberg (strain SL476)
B5R739 8.04e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX43 8.04e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella enteritidis PT4 (strain P125109)
B5F050 8.04e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella agona (strain SL483)
Q88YY8 8.09e-05 45 31 2 97 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8Z8B2 8.12e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella typhi
B4TQR7 8.12e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella schwarzengrund (strain CVM19633)
C0PWW0 8.12e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella paratyphi C (strain RKS4594)
B4SZH5 8.12e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella newport (strain SL254)
Q57RI5 8.12e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella choleraesuis (strain SC-B67)
B5FP39 8.83e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Salmonella dublin (strain CT_02021853)
A7MIX7 9.17e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cronobacter sakazakii (strain ATCC BAA-894)
A4W897 9.89e-05 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Enterobacter sp. (strain 638)
B3DZZ7 0.000102 45 28 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylacidiphilum infernorum (isolate V4)
Q7NK82 0.000104 45 34 0 63 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q32IH0 0.000107 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella dysenteriae serotype 1 (strain Sd197)
A7ZJD0 0.00011 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z455 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella sonnei (strain Ss046)
P62710 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella flexneri
Q0T6Y5 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella flexneri serotype 5b (strain 8401)
Q324G4 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella boydii serotype 4 (strain Sb227)
B2TUY6 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK04 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LM46 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7Q9 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain SE11)
B7N9Z7 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62707 0.000113 45 28 2 107 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12)
B1IXY1 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62708 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJU6 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8Z8 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O1:K1 / APEC
A7ZY11 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O9:H4 (strain HS)
B1X786 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12 / DH10B)
C4ZXS6 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6B8 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O8 (strain IAI1)
B7MPN9 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O81 (strain ED1a)
B7NNH7 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YRF2 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62709 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O157:H7
B7LAF6 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli (strain 55989 / EAEC)
B7MGL2 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7ULM8 0.000113 45 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q5H2V7 0.000113 45 29 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P5R0 0.000113 45 29 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BR53 0.000113 45 29 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
C6DCF6 0.000123 45 27 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A0PVZ3 0.000126 45 32 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium ulcerans (strain Agy99)
Q11SV1 0.000134 44 27 4 162 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q74L45 0.000136 45 32 3 97 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q7MXP1 0.000136 45 28 2 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RHB7 0.000136 45 28 2 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B2HQV4 0.000138 45 32 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium marinum (strain ATCC BAA-535 / M)
P57390 0.000142 45 24 4 204 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
C0QV47 0.000147 45 29 3 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A9KN01 0.000148 45 31 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B9JYQ2 0.00015 44 29 4 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q83FQ7 0.000152 44 25 4 131 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Tropheryma whipplei (strain Twist)
Q83HD5 0.000152 44 25 4 131 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Tropheryma whipplei (strain TW08/27)
Q6MEW4 0.00016 44 37 0 61 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Protochlamydia amoebophila (strain UWE25)
Q8PIM1 0.000164 44 29 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas axonopodis pv. citri (strain 306)
B8D7J7 0.000164 44 24 4 204 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D995 0.000164 44 24 4 204 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B5EC38 0.000168 44 24 4 145 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A8GBA2 0.000172 44 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Serratia proteamaculans (strain 568)
B0UBD4 0.000176 44 30 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium sp. (strain 4-46)
P15259 0.000179 44 31 2 106 1 PGAM2 Phosphoglycerate mutase 2 Homo sapiens
Q6NJL2 0.000188 44 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
O94420 0.000188 44 30 2 101 3 SPCC1620.13 Probable phosphatase C1620.13 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A4T096 0.000189 44 30 3 109 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A6L9K8 0.000189 44 29 2 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q21YW0 0.000209 44 30 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B4RZM6 0.000212 44 33 2 102 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C5CWV9 0.000215 44 32 4 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Variovorax paradoxus (strain S110)
B2SRM8 0.000234 44 29 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthomonas oryzae pv. oryzae (strain PXO99A)
A6US15 0.000235 44 33 0 62 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
P53531 0.000351 43 29 3 110 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium leprae (strain TN)
B8ZT86 0.000351 43 29 3 110 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium leprae (strain Br4923)
C6E639 0.000378 43 25 5 149 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Geobacter sp. (strain M21)
Q0RS35 0.000388 43 28 2 105 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B7KIT8 0.000394 43 38 1 65 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Gloeothece citriformis (strain PCC 7424)
B3QPN8 0.000408 43 28 3 108 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q82XS4 0.000474 43 33 3 92 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A6LUA1 0.000546 43 30 3 109 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q92T25 0.000572 43 28 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium meliloti (strain 1021)
Q8NTA5 0.000579 43 32 2 93 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB41 0.000579 43 32 2 93 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain R)
B2VBS6 0.000588 43 28 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4SEI0 0.000592 43 28 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A6T6I3 0.000622 43 27 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZB2 0.000622 43 27 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Klebsiella pneumoniae (strain 342)
Q1MMY4 0.000698 42 29 4 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B1XS92 0.000734 42 29 3 109 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B4M7S0 0.000751 43 25 7 178 3 Pgam5 Serine/threonine-protein phosphatase Pgam5, mitochondrial Drosophila virilis
P9WIC9 0.000783 42 30 2 102 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC8 0.000783 42 30 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZL7 0.000783 42 30 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKG7 0.000783 42 30 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFW3 0.000783 42 30 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5R7 0.000783 42 30 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q32KV0 0.000802 42 32 2 106 2 PGAM2 Phosphoglycerate mutase 2 Bos taurus
A8AJ40 0.000855 42 27 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2NUK6 0.000871 42 27 2 107 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sodalis glossinidius (strain morsitans)
A7GPN5 0.001 42 29 2 103 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A9M1A2 0.001 42 26 2 102 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Neisseria meningitidis serogroup C (strain 053442)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17015
Feature type CDS
Gene cobC
Product alpha-ribazole phosphatase
Location 11138 - 11764 (strand: -1)
Length 627 (nucleotides) / 208 (amino acids)

Contig

Accession ZDB_231
Length 52966 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3074
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00300 Histidine phosphatase superfamily (branch 1)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0406 Carbohydrate transport and metabolism (G) G Broad specificity phosphatase PhoE

Kegg Ortholog Annotation(s)

Protein Sequence

MSISRFILVRHGETAGNKDGLFYGSTDLPLTEHGHRQAATVASYLPDIQIDTILISELQRARQTAEYIRPPENHHYHCDPRLNEMHFGEWEMQHYSEIAARFPADWETWMNDWLHAAPTGGEPFPQFAARVQAVADELRREASETPATRLIVAHKGVLGLIITRWFGLPAEAMWQFPCEQDSYSVAECRDGFMTLAVFNGRSRFTPVV

Flanking regions ( +/- flanking 50bp)

AGAGTGCGGGGAAATTATCTTCCTGCTCGCGCTGTTCTGGGTTTAAGCAGATGAGTATCAGCCGCTTTATTCTTGTCCGCCACGGGGAAACCGCCGGGAACAAAGACGGTTTGTTCTACGGCAGCACCGATTTACCGCTGACGGAACACGGTCACCGTCAGGCGGCAACCGTGGCCTCTTATCTGCCGGATATTCAGATAGATACTATACTGATCAGTGAATTACAGCGGGCAAGACAGACAGCAGAATACATCCGCCCGCCGGAAAATCATCACTATCATTGCGACCCGCGCCTCAATGAGATGCACTTCGGAGAGTGGGAAATGCAGCATTACAGTGAGATTGCCGCCCGTTTCCCGGCAGACTGGGAGACCTGGATGAATGACTGGCTGCATGCGGCACCCACCGGCGGCGAGCCGTTCCCGCAGTTTGCGGCGAGGGTTCAGGCGGTGGCGGATGAACTGCGCCGGGAAGCATCAGAAACCCCGGCAACCCGGCTGATTGTCGCCCACAAGGGCGTGCTCGGGCTTATCATCACCCGCTGGTTCGGCCTGCCCGCAGAGGCCATGTGGCAATTCCCCTGTGAACAGGACAGTTACAGTGTGGCGGAATGCCGCGACGGATTTATGACGTTAGCTGTGTTTAACGGGCGATCACGTTTTACGCCTGTTGTTTGATTATAAAAATATAATGTGAGCATAAAAACAATGACAAAACTGAAAGACCT