Homologs in group_3954
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| Q8FBI4 | 5.29e-15 | 68 | 48 | 1 | 72 | 1 | rfaH | Transcription antitermination protein RfaH | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Q0TAL4 | 5.29e-15 | 68 | 48 | 1 | 72 | 1 | rfaH | Transcription antitermination protein RfaH | Escherichia coli O6:K15:H31 (strain 536 / UPEC) |
| P0AFW0 | 9.45e-15 | 67 | 48 | 1 | 72 | 1 | rfaH | Transcription antitermination protein RfaH | Escherichia coli (strain K12) |
| P0AFW1 | 9.45e-15 | 67 | 48 | 1 | 72 | 3 | rfaH | Transcription antitermination protein RfaH | Escherichia coli O157:H7 |
| Source | Morganella morganii S2 |
|---|---|
| Locus tag | EHELCC_16680 |
| Feature type | CDS |
| Gene | - |
| Product | hypothetical protein |
| Location | 56910 - 57128 (strand: -1) |
| Length | 219 (nucleotides) / 72 (amino acids) |
| Accession | ZDB_229 |
|---|---|
| Length | 57314 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3954 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG0250 | Transcription (K) | K | Transcription termination/antitermination protein NusG |
MIEELKNAECVSLSEQNVPQPGDIVEITEGMFKGLEAIYQEPDGDTRSVLLLTLISKELTKKVDNTSFIRKL
TCAATCATTTCGTCCGTTTCGGACCACTGCCTGCCGTTGTTCCCGCATCATTGATTGAAGAGCTGAAAAATGCCGAATGTGTCAGCCTGTCAGAGCAAAATGTTCCGCAGCCGGGGGATATTGTGGAAATCACTGAAGGGATGTTTAAAGGCCTGGAAGCGATTTATCAGGAGCCGGACGGCGACACCCGCTCCGTGCTGCTGCTGACGCTGATCAGTAAAGAGCTGACCAAAAAAGTGGATAACACCAGCTTTATCCGGAAACTCTGAGTATCTCCGTCACCCGGAAACAAAAAACCGCCCTGTTATTAAGGCGGTTT
