Homologs in group_3460

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15675 FBDBKF_15675 100.0 Morganella morganii S1 - Transposon Tn552 DNA-invertase bin3
NLDBIP_16335 NLDBIP_16335 100.0 Morganella morganii S4 - Transposon Tn552 DNA-invertase bin3
LHKJJB_16465 LHKJJB_16465 100.0 Morganella morganii S3 - Transposon Tn552 DNA-invertase bin3
HKOGLL_16235 HKOGLL_16235 100.0 Morganella morganii S5 - Transposon Tn552 DNA-invertase bin3

Distribution of the homologs in the orthogroup group_3460

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3460

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22996 1.56e-33 122 38 3 190 3 parA Resolvase Escherichia coli
Q52563 1.29e-30 114 35 3 191 3 stbA Resolvase Pseudomonas syringae pv. tomato
P55559 1.51e-11 63 32 5 165 3 NGR_a02590 Integrase-like protein y4lS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P04130 7.65e-11 62 30 6 195 3 tnpR Transposon Tn21 resolvase Escherichia coli
P20384 2.87e-10 60 27 6 206 1 bin3 Putative transposon Tn552 DNA-invertase bin3 Staphylococcus aureus
P0C1G3 4.65e-10 59 32 5 166 3 tnpR Transposons Tn4653 resolvase Pseudomonas putida
P0C1G2 4.65e-10 59 32 5 166 3 tnpR Transposons Tn1721 resolvase Escherichia coli
P05823 9.03e-10 59 29 6 206 3 tnpR Transposon Tn2501 resolvase Escherichia coli
P06691 1.58e-09 58 31 5 166 3 tnpR Transposon Tn501 resolvase Pseudomonas aeruginosa
Q06237 1.77e-09 58 29 5 159 3 None Transposon Tn1546 resolvase Enterococcus faecium
P77170 1.67e-08 55 31 6 200 3 pinQ Serine recombinase PinQ Escherichia coli (strain K12)
P0ADI0 3.29e-08 55 30 6 200 1 pinR Serine recombinase PinR Escherichia coli (strain K12)
P0ADI1 3.29e-08 55 30 6 200 3 pinR Putative DNA-invertase from lambdoid prophage Rac Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P07945 4.67e-08 54 25 8 202 3 res Resolvase Clostridium perfringens
Q93MD2 8.55e-08 53 25 8 203 3 res Resolvase Clostridium perfringens (strain 13 / Type A)
P03013 6.01e-06 48 25 6 190 1 hin DNA-invertase hin Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P19241 1.2e-05 47 27 5 174 3 resR Transposon Tn552 DNA-invertase BinR Staphylococcus aureus
Q02869 3.81e-05 46 25 6 190 3 hin DNA-invertase Salmonella abortus-equi
P06693 5.34e-05 45 24 5 194 3 tnpR Transposon Tn917 resolvase Enterococcus faecalis
P03014 0.000535 42 21 3 166 3 pinE Serine recombinase PinE Escherichia coli (strain K12)
Q38199 0.000746 42 22 3 164 2 gin Serine recombinase gin Escherichia phage D108
P03015 0.000767 42 22 3 164 1 gin Serine recombinase gin Escherichia phage Mu
P30739 0.001 42 24 6 201 3 None Resolvase/recombinase Pseudomonas putida

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_16030
Feature type CDS
Gene -
Product Transposon Tn552 DNA-invertase bin3
Location 69106 - 69732 (strand: -1)
Length 627 (nucleotides) / 208 (amino acids)

Contig

Accession ZDB_227
Length 79950 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3460
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00239 Resolvase, N terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1961 Replication, recombination and repair (L) L Site-specific DNA recombinase SpoIVCA/DNA invertase PinE

Protein Sequence

MFIRAYLRASTKEQNAERARESLIQFVAQHGQRIAAFYIENVSGATLHRPELMRLIAESGEGDIVLVEQIDRLARLKQSDWDTLKQKLASKRLAIVSPELPTSWLALQQHSETDFTGAILQAVNAMMLDMLAAVARKDYDDRRRRQSQGIAKAKSDGKYNGRQPDLKRHQHIASLLKTGHSYSDIQDMLGCSRHLIAAVSKNMSSAEQ

Flanking regions ( +/- flanking 50bp)

ACACCAGACCAGAGATAAAGCACCACTTATAACAGACTGTGGAGATCAATATGTTCATTCGAGCTTACCTTCGCGCATCAACCAAAGAACAAAATGCTGAACGGGCACGCGAATCACTCATTCAGTTTGTTGCTCAGCATGGCCAGCGAATCGCCGCTTTTTATATCGAGAATGTTTCTGGTGCCACATTGCACCGGCCTGAGTTGATGCGTTTGATTGCCGAGTCAGGCGAGGGTGACATTGTGCTGGTTGAACAAATTGACCGTCTGGCGCGACTTAAACAAAGTGACTGGGACACGTTGAAACAGAAGCTAGCCAGCAAACGCCTAGCCATTGTTTCACCGGAACTTCCTACCAGTTGGCTGGCTTTGCAACAACATAGCGAAACTGACTTCACCGGCGCTATTTTACAGGCGGTGAATGCCATGATGTTGGACATGCTCGCTGCCGTTGCTCGCAAAGATTATGATGACCGGCGACGTCGTCAATCACAGGGAATCGCAAAGGCTAAATCCGATGGGAAATACAACGGGCGTCAGCCTGACCTTAAACGTCACCAGCACATAGCCAGCCTACTGAAAACTGGGCATAGCTATAGTGACATTCAGGACATGTTGGGGTGTTCGCGGCACCTGATTGCTGCAGTATCAAAGAATATGAGCAGCGCAGAGCAGTAATTCAACTACTTTTCGCCGTATCATTGTCTTGATTACGGCAACTCAACGTC