Homologs in group_1986

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14895 FBDBKF_14895 100.0 Morganella morganii S1 rplY 50S ribosomal protein L25
NLDBIP_16230 NLDBIP_16230 100.0 Morganella morganii S4 rplY 50S ribosomal protein L25
LHKJJB_15610 LHKJJB_15610 100.0 Morganella morganii S3 rplY 50S ribosomal protein L25
HKOGLL_14730 HKOGLL_14730 100.0 Morganella morganii S5 rplY 50S ribosomal protein L25
F4V73_RS07695 F4V73_RS07695 91.4 Morganella psychrotolerans rplY 50S ribosomal protein L25
PMI_RS04055 PMI_RS04055 77.4 Proteus mirabilis HI4320 rplY 50S ribosomal protein L25

Distribution of the homologs in the orthogroup group_1986

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1986

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N352 8.52e-54 165 87 1 94 3 rplY Large ribosomal subunit protein bL25 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7MLN0 2.52e-50 156 79 1 94 3 rplY Large ribosomal subunit protein bL25 Cronobacter sakazakii (strain ATCC BAA-894)
A9MK27 1.34e-49 154 76 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5RC63 4.77e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q7CQ71 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFE7 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella typhi
B4TPC7 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella schwarzengrund (strain CVM19633)
B5BE12 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella paratyphi A (strain AKU_12601)
C0Q0R6 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella paratyphi C (strain RKS4594)
A9N6F6 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PE20 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYR0 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella newport (strain SL254)
B4TAP8 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella heidelberg (strain SL476)
B5R194 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella enteritidis PT4 (strain P125109)
B5FNN0 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella dublin (strain CT_02021853)
Q57MB4 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella choleraesuis (strain SC-B67)
B5EYS6 5.75e-49 153 75 1 94 3 rplY Large ribosomal subunit protein bL25 Salmonella agona (strain SL483)
B2VII8 8.82e-49 152 77 1 94 3 rplY Large ribosomal subunit protein bL25 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8AE31 9.01e-49 152 75 1 94 3 rplY Large ribosomal subunit protein bL25 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GGW2 1.61e-48 152 79 1 93 3 rplY Large ribosomal subunit protein bL25 Serratia proteamaculans (strain 568)
B4ET93 3.36e-48 151 76 1 94 3 rplY Large ribosomal subunit protein bL25 Proteus mirabilis (strain HI4320)
Q2NSM8 5.05e-48 150 76 1 94 3 rplY Large ribosomal subunit protein bL25 Sodalis glossinidius (strain morsitans)
B5XP25 5.27e-48 150 78 1 94 3 rplY Large ribosomal subunit protein bL25 Klebsiella pneumoniae (strain 342)
A6TBR5 1.9e-47 149 76 1 94 3 rplY Large ribosomal subunit protein bL25 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2TV63 3.84e-47 148 74 1 94 3 rplY Large ribosomal subunit protein bL25 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z022 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Shigella sonnei (strain Ss046)
P68918 9.77e-47 147 73 1 94 1 rplY Large ribosomal subunit protein bL25 Shigella flexneri
Q32HY5 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Shigella dysenteriae serotype 1 (strain Sd197)
B6I184 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain SE11)
P68919 9.77e-47 147 73 1 94 1 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain K12)
B1IY84 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A248 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O9:H4 (strain HS)
B1X883 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain K12 / DH10B)
C4ZU30 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M535 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O8 (strain IAI1)
B7LAK9 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain 55989 / EAEC)
A7ZP09 9.77e-47 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31YZ2 1.48e-46 147 73 1 94 3 rplY Large ribosomal subunit protein bL25 Shigella boydii serotype 4 (strain Sb227)
B5YWX8 2.8e-46 146 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE69 2.8e-46 146 73 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O157:H7
B1LKT4 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli (strain SMS-3-5 / SECEC)
B7N5E9 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FFS1 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFQ4 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXK1 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O81 (strain ED1a)
B7NN00 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFA0 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFK2 1.06e-45 144 71 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1JS45 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CV3 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNE3 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pestis (strain Pestoides F)
Q1CG40 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3I4 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGM4 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pestis
B2K9F2 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9C3 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKA7 2.23e-45 144 75 1 93 3 rplY Large ribosomal subunit protein bL25 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B7LJS7 3.34e-45 143 70 1 94 3 rplY Large ribosomal subunit protein bL25 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WCL6 6.9e-45 142 72 1 94 3 rplY Large ribosomal subunit protein bL25 Enterobacter sp. (strain 638)
C6DEJ2 5.73e-44 140 74 1 93 3 rplY Large ribosomal subunit protein bL25 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JLN0 2.13e-43 139 71 1 94 3 rplY Large ribosomal subunit protein bL25 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D3J9 1.02e-42 137 73 1 93 3 rplY Large ribosomal subunit protein bL25 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BG54 1.05e-42 137 68 1 94 3 rplY Large ribosomal subunit protein bL25 Edwardsiella ictaluri (strain 93-146)
Q5E6I9 5.73e-39 127 65 0 91 3 rplY Large ribosomal subunit protein bL25 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FCG1 4.04e-38 125 64 0 91 3 rplY Large ribosomal subunit protein bL25 Aliivibrio fischeri (strain MJ11)
Q659V3 7.46e-38 124 63 0 92 3 rplY Large ribosomal subunit protein bL25 Photobacterium damsela subsp. piscicida
P45281 2.91e-37 123 65 1 93 3 rplY Large ribosomal subunit protein bL25 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UIZ5 3.54e-37 123 66 1 93 3 rplY Large ribosomal subunit protein bL25 Haemophilus influenzae (strain PittGG)
A5UCM3 4.13e-37 123 66 1 93 3 rplY Large ribosomal subunit protein bL25 Haemophilus influenzae (strain PittEE)
Q4QL66 4.13e-37 123 66 1 93 3 rplY Large ribosomal subunit protein bL25 Haemophilus influenzae (strain 86-028NP)
B6EI32 4.87e-37 122 65 0 91 3 rplY Large ribosomal subunit protein bL25 Aliivibrio salmonicida (strain LFI1238)
Q65TI7 6.13e-37 122 65 1 93 3 rplY Large ribosomal subunit protein bL25 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VQ17 2.24e-36 121 64 1 93 3 rplY Large ribosomal subunit protein bL25 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q87QD9 1.88e-35 119 62 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CN10 3.05e-35 118 62 1 93 3 rplY Large ribosomal subunit protein bL25 Pasteurella multocida (strain Pm70)
C3LMW6 4.61e-35 117 61 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio cholerae serotype O1 (strain M66-2)
Q9KRK0 4.61e-35 117 61 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F7P6 4.61e-35 117 61 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C4LFH4 6.54e-35 117 60 1 93 3 rplY Large ribosomal subunit protein bL25 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7MLK7 7.07e-35 117 59 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio vulnificus (strain YJ016)
Q8D8W6 7.07e-35 117 59 0 91 1 rplY Large ribosomal subunit protein bL25 Vibrio vulnificus (strain CMCP6)
B7VPU4 8.99e-35 117 61 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio atlanticus (strain LGP32)
A7MZG9 9.92e-35 117 61 0 91 3 rplY Large ribosomal subunit protein bL25 Vibrio campbellii (strain ATCC BAA-1116)
B0BU91 1.11e-34 117 65 1 89 3 rplY Large ribosomal subunit protein bL25 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GX65 1.11e-34 117 65 1 89 3 rplY Large ribosomal subunit protein bL25 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZK5 4.76e-34 115 64 1 88 3 rplY Large ribosomal subunit protein bL25 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0UU73 8.05e-34 114 61 1 92 3 rplY Large ribosomal subunit protein bL25 Histophilus somni (strain 2336)
Q0I3J3 8.05e-34 114 61 1 92 3 rplY Large ribosomal subunit protein bL25 Histophilus somni (strain 129Pt)
Q6LRY1 6.83e-33 112 60 0 91 3 rplY Large ribosomal subunit protein bL25 Photobacterium profundum (strain SS9)
A4SMM4 4.74e-32 110 57 1 92 3 rplY Large ribosomal subunit protein bL25 Aeromonas salmonicida (strain A449)
B8F4P6 5.24e-32 110 62 1 88 3 rplY Large ribosomal subunit protein bL25 Glaesserella parasuis serovar 5 (strain SH0165)
Q8EF74 1.5e-31 108 54 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VLY6 2.56e-31 108 62 1 88 3 rplY Large ribosomal subunit protein bL25 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q0HUS4 1.4e-30 106 53 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella sp. (strain MR-7)
Q0HJ59 1.4e-30 106 53 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella sp. (strain MR-4)
A0KWF4 1.4e-30 106 53 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella sp. (strain ANA-3)
A1S615 1.46e-30 106 55 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8FW35 1.48e-30 106 55 1 89 3 rplY Large ribosomal subunit protein bL25 Shewanella sediminis (strain HAW-EB3)
A9KZ17 1.6e-30 106 54 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella baltica (strain OS195)
A6WMN1 1.6e-30 106 54 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella baltica (strain OS185)
A3D3U4 1.6e-30 106 54 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E7C8 1.6e-30 106 54 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella baltica (strain OS223)
A3QDZ8 4.38e-30 105 53 1 89 3 rplY Large ribosomal subunit protein bL25 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1RJU6 1.84e-29 103 53 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella sp. (strain W3-18-1)
A4Y6N5 1.84e-29 103 53 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B8D743 4.04e-29 102 56 1 92 3 rplY Large ribosomal subunit protein bL25 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57238 4.04e-29 102 56 1 92 3 rplY Large ribosomal subunit protein bL25 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8T9 4.04e-29 102 56 1 92 3 rplY Large ribosomal subunit protein bL25 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4IY68 2.42e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NH01 2.42e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q6N0 2.42e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. novicida (strain U112)
B2SH55 2.42e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14IF3 2.42e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BM50 3.72e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3P1 3.72e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. holarctica (strain LVS)
A7NBX3 3.72e-28 100 54 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B0TZF1 5.63e-28 100 53 1 92 3 rplY Large ribosomal subunit protein bL25 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B8CPE2 7.2e-28 99 52 1 89 3 rplY Large ribosomal subunit protein bL25 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q3IK85 8.19e-28 102 55 1 89 3 rplY Large ribosomal subunit protein bL25 Pseudoalteromonas translucida (strain TAC 125)
Q084M1 1.18e-27 99 53 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella frigidimarina (strain NCIMB 400)
Q12P38 1.37e-27 99 51 1 90 3 rplY Large ribosomal subunit protein bL25 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B1KDP2 3.26e-27 98 50 1 92 3 rplY Large ribosomal subunit protein bL25 Shewanella woodyi (strain ATCC 51908 / MS32)
Q8KA03 3.32e-27 98 47 1 94 3 rplY Large ribosomal subunit protein bL25 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B4RSW4 1.07e-26 100 51 1 93 3 rplY Large ribosomal subunit protein bL25 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0TIW4 1.16e-26 96 50 1 89 3 rplY Large ribosomal subunit protein bL25 Shewanella halifaxensis (strain HAW-EB4)
Q47Y88 1.01e-25 97 50 1 93 3 rplY Large ribosomal subunit protein bL25 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A8H3Z4 1.13e-25 94 49 1 89 3 rplY Large ribosomal subunit protein bL25 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q7NQT0 1.55e-25 94 52 1 85 3 rplY Large ribosomal subunit protein bL25 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q15SQ3 6.51e-25 95 48 1 93 3 rplY Large ribosomal subunit protein bL25 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QV04 4.18e-24 94 47 1 92 3 rplY Large ribosomal subunit protein bL25 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q60A15 5.1e-24 93 51 1 92 3 rplY Large ribosomal subunit protein bL25 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A9I6W5 7.86e-24 92 47 1 92 3 rplY Large ribosomal subunit protein bL25 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q0ABZ8 2.23e-23 91 50 3 95 3 rplY Large ribosomal subunit protein bL25 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q7W180 3.58e-23 90 48 2 93 3 rplY Large ribosomal subunit protein bL25 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WNY3 3.58e-23 90 48 2 93 3 rplY Large ribosomal subunit protein bL25 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VUH2 5.44e-23 90 48 2 93 3 rplY Large ribosomal subunit protein bL25 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q479M1 2.32e-22 89 48 1 90 3 rplY Large ribosomal subunit protein bL25 Dechloromonas aromatica (strain RCB)
B8GLA7 3.79e-22 88 48 1 90 3 rplY Large ribosomal subunit protein bL25 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q5GWR5 4e-22 88 48 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NZW8 4e-22 88 48 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5CVE7 6.3e-22 88 50 2 95 3 rplY Large ribosomal subunit protein bL25 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
C1DBA9 6.89e-22 87 47 1 92 3 rplY Large ribosomal subunit protein bL25 Laribacter hongkongensis (strain HLHK9)
B0U5Y7 2.74e-21 86 46 2 91 3 rplY Large ribosomal subunit protein bL25 Xylella fastidiosa (strain M12)
Q8PC62 2.76e-21 86 47 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU99 2.76e-21 86 47 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas campestris pv. campestris (strain B100)
Q4URC2 2.76e-21 86 47 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas campestris pv. campestris (strain 8004)
Q87A23 3.25e-21 85 46 2 91 3 rplY Large ribosomal subunit protein bL25 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA79 3.25e-21 85 46 2 91 3 rplY Large ribosomal subunit protein bL25 Xylella fastidiosa (strain M23)
Q3BX01 3.56e-21 85 47 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNT9 3.56e-21 85 47 1 90 3 rplY Large ribosomal subunit protein bL25 Xanthomonas axonopodis pv. citri (strain 306)
Q2KYA2 3.87e-21 85 45 2 93 3 rplY Large ribosomal subunit protein bL25 Bordetella avium (strain 197N)
A1AXW4 4.19e-21 85 49 2 95 3 rplY Large ribosomal subunit protein bL25 Ruthia magnifica subsp. Calyptogena magnifica
Q1LRQ2 5e-21 85 49 1 85 3 rplY Large ribosomal subunit protein bL25 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2YBH3 5.46e-21 85 46 1 92 3 rplY Large ribosomal subunit protein bL25 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3SLR4 6.27e-21 85 46 1 92 3 rplY Large ribosomal subunit protein bL25 Thiobacillus denitrificans (strain ATCC 25259)
Q89AV5 6.34e-21 82 48 3 96 3 rplY Large ribosomal subunit protein bL25 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A3M2X2 6.37e-21 82 48 2 95 3 rplY Large ribosomal subunit protein bL25 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q9PA77 6.44e-21 85 46 2 91 3 rplY Large ribosomal subunit protein bL25 Xylella fastidiosa (strain 9a5c)
B2AGT7 7.19e-21 85 49 1 85 3 rplY Large ribosomal subunit protein bL25 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q2SLA2 8.06e-21 85 46 2 93 3 rplY Large ribosomal subunit protein bL25 Hahella chejuensis (strain KCTC 2396)
A1WGH1 1.34e-20 85 51 1 85 3 rplY Large ribosomal subunit protein bL25 Verminephrobacter eiseniae (strain EF01-2)
B7I7B6 1.48e-20 81 48 2 95 1 rplY Large ribosomal subunit protein bL25 Acinetobacter baumannii (strain AB0057)
B7GYQ9 1.48e-20 81 48 2 95 3 rplY Large ribosomal subunit protein bL25 Acinetobacter baumannii (strain AB307-0294)
Q21XW2 1.55e-20 84 49 1 85 3 rplY Large ribosomal subunit protein bL25 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1STD7 1.99e-20 84 46 1 90 3 rplY Large ribosomal subunit protein bL25 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3JDQ8 2.38e-20 84 43 2 94 3 rplY Large ribosomal subunit protein bL25 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q476G0 2.55e-20 83 48 1 85 3 rplY Large ribosomal subunit protein bL25 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B3PJN6 3.09e-20 83 45 2 91 3 rplY Large ribosomal subunit protein bL25 Cellvibrio japonicus (strain Ueda107)
A4VPC5 3.36e-20 83 48 3 95 3 rplY Large ribosomal subunit protein bL25 Stutzerimonas stutzeri (strain A1501)
A1W4G1 3.57e-20 83 48 1 85 3 rplY Large ribosomal subunit protein bL25 Acidovorax sp. (strain JS42)
B9ME47 3.57e-20 83 48 1 85 3 rplY Large ribosomal subunit protein bL25 Acidovorax ebreus (strain TPSY)
A5IAS4 3.88e-20 83 41 2 93 3 rplY Large ribosomal subunit protein bL25 Legionella pneumophila (strain Corby)
Q5WTE8 3.93e-20 83 41 2 93 3 rplY Large ribosomal subunit protein bL25 Legionella pneumophila (strain Lens)
Q5ZS67 3.93e-20 83 41 2 93 3 rplY Large ribosomal subunit protein bL25 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X1N8 3.93e-20 83 41 2 93 3 rplY Large ribosomal subunit protein bL25 Legionella pneumophila (strain Paris)
Q492J6 4.52e-20 80 47 3 97 3 rplY Large ribosomal subunit protein bL25 Blochmanniella pennsylvanica (strain BPEN)
A5EWV0 4.58e-20 83 47 2 92 3 rplY Large ribosomal subunit protein bL25 Dichelobacter nodosus (strain VCS1703A)
C1DEV6 5.2e-20 82 48 3 95 3 rplY Large ribosomal subunit protein bL25 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q0KEP9 5.74e-20 82 48 1 85 3 rplY Large ribosomal subunit protein bL25 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A4T069 1.05e-19 82 50 1 85 3 rplY Large ribosomal subunit protein bL25 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1TT74 1.21e-19 82 49 1 85 3 rplY Large ribosomal subunit protein bL25 Paracidovorax citrulli (strain AAC00-1)
Q82TQ5 1.49e-19 81 44 1 92 3 rplY Large ribosomal subunit protein bL25 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A9AEY7 2.22e-19 81 49 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia multivorans (strain ATCC 17616 / 249)
B1Y3Q0 4.73e-19 80 47 1 85 3 rplY Large ribosomal subunit protein bL25 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q0BBQ4 5.93e-19 80 48 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YN53 5.93e-19 80 48 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia ambifaria (strain MC40-6)
Q39CT9 6.54e-19 79 48 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A1VKN7 7.28e-19 80 45 1 85 3 rplY Large ribosomal subunit protein bL25 Polaromonas naphthalenivorans (strain CJ2)
Q12E00 7.77e-19 80 49 1 85 3 rplY Large ribosomal subunit protein bL25 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q88PX7 7.9e-19 79 45 1 92 3 rplY Large ribosomal subunit protein bL25 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A4JHZ6 1.05e-18 79 48 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia vietnamiensis (strain G4 / LMG 22486)
A6W1C8 1.07e-18 79 41 1 93 3 rplY Large ribosomal subunit protein bL25 Marinomonas sp. (strain MWYL1)
A1UZN7 1.76e-18 79 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia mallei (strain SAVP1)
Q62FC2 1.76e-18 79 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia mallei (strain ATCC 23344)
A3MQB4 1.76e-18 79 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia mallei (strain NCTC 10247)
Q63XL9 1.96e-18 79 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia pseudomallei (strain K96243)
Q3JW87 1.96e-18 79 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia pseudomallei (strain 1710b)
Q1QXD2 1.96e-18 79 43 2 93 3 rplY Large ribosomal subunit protein bL25 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1BTG5 2.03e-18 78 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia orbicola (strain AU 1054)
B1JYQ0 2.03e-18 78 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia orbicola (strain MC0-3)
A0KAM6 2.03e-18 78 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia cenocepacia (strain HI2424)
Q2T1B8 2.66e-18 78 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B4RKF2 3.31e-18 77 44 1 88 3 rplY Large ribosomal subunit protein bL25 Neisseria gonorrhoeae (strain NCCP11945)
Q5F9F4 3.31e-18 77 44 1 88 3 rplY Large ribosomal subunit protein bL25 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JZW3 3.38e-18 77 44 1 88 3 rplY Large ribosomal subunit protein bL25 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M423 3.38e-18 77 44 1 88 3 rplY Large ribosomal subunit protein bL25 Neisseria meningitidis serogroup C (strain 053442)
A3N5K0 3.44e-18 78 47 1 85 3 rplY Large ribosomal subunit protein bL25 Burkholderia pseudomallei (strain 668)
Q6F8I8 3.65e-18 75 46 2 95 3 rplY Large ribosomal subunit protein bL25 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1KTB7 3.85e-18 77 44 1 88 3 rplY Large ribosomal subunit protein bL25 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JUX7 3.89e-18 77 44 1 88 3 rplY Large ribosomal subunit protein bL25 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1U373 5.66e-18 77 47 3 95 3 rplY Large ribosomal subunit protein bL25 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q888C7 6.47e-18 77 45 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K6W3 9.26e-18 77 46 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas fluorescens (strain Pf0-1)
B1XS65 1.09e-17 77 48 1 85 3 rplY Large ribosomal subunit protein bL25 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A9BP18 1.22e-17 76 44 1 85 3 rplY Large ribosomal subunit protein bL25 Delftia acidovorans (strain DSM 14801 / SPH-1)
C3KCS0 1.29e-17 76 45 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas fluorescens (strain SBW25)
C5CYZ6 1.36e-17 77 47 1 85 3 rplY Large ribosomal subunit protein bL25 Variovorax paradoxus (strain S110)
Q1H3J2 1.74e-17 76 42 1 92 3 rplY Large ribosomal subunit protein bL25 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q4K689 1.76e-17 76 44 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A6VC67 1.83e-17 76 43 2 91 3 rplY Large ribosomal subunit protein bL25 Pseudomonas aeruginosa (strain PA7)
Q8Y2E2 1.96e-17 76 47 1 85 3 rplY Large ribosomal subunit protein bL25 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9HVC4 1.97e-17 76 45 2 91 1 rplY Large ribosomal subunit protein bL25 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V0L7 1.97e-17 76 45 2 91 3 rplY Large ribosomal subunit protein bL25 Pseudomonas aeruginosa (strain LESB58)
Q02G03 2.1e-17 75 45 2 91 1 rplY Large ribosomal subunit protein bL25 Pseudomonas aeruginosa (strain UCBPP-PA14)
B1JEQ2 2.51e-17 75 42 1 92 3 rplY Large ribosomal subunit protein bL25 Pseudomonas putida (strain W619)
Q4ZXX3 2.93e-17 75 45 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas syringae pv. syringae (strain B728a)
A2SKU2 3.08e-17 75 45 2 85 3 rplY Large ribosomal subunit protein bL25 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B2UER5 4.86e-17 75 45 1 85 3 rplY Large ribosomal subunit protein bL25 Ralstonia pickettii (strain 12J)
Q2G6G9 8.39e-17 74 39 1 93 3 rplY Large ribosomal subunit protein bL25 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q48MW0 9.17e-17 74 44 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4UMK5 1.2e-16 73 42 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8EY64 1.86e-16 73 41 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia canadensis (strain McKiel)
A4WPE3 1.89e-16 73 44 2 89 3 rplY Large ribosomal subunit protein bL25 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q145X3 1.94e-16 73 44 1 85 3 rplY Large ribosomal subunit protein bL25 Paraburkholderia xenovorans (strain LB400)
B0KND5 1.95e-16 73 41 1 92 3 rplY Large ribosomal subunit protein bL25 Pseudomonas putida (strain GB-1)
B2SXG4 1.97e-16 73 44 1 85 3 rplY Large ribosomal subunit protein bL25 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A8GP85 2.02e-16 73 40 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia akari (strain Hartford)
Q5P723 2.16e-16 73 40 1 92 3 rplY Large ribosomal subunit protein bL25 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1IEY7 2.23e-16 73 41 1 92 3 rplY Large ribosomal subunit protein bL25 Pseudomonas entomophila (strain L48)
B9KMG3 3.05e-16 73 44 2 89 3 rplY Large ribosomal subunit protein bL25 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IZM8 3.05e-16 73 44 2 89 3 rplY Large ribosomal subunit protein bL25 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PMM1 3.05e-16 73 44 2 89 3 rplY Large ribosomal subunit protein bL25 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q4FVB4 3.38e-16 73 45 1 82 3 rplY Large ribosomal subunit protein bL25 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B9KHC7 3.8e-16 73 38 1 88 3 rplY Large ribosomal subunit protein bL25 Anaplasma marginale (strain Florida)
Q1GSP2 4.16e-16 72 41 1 92 3 rplY Large ribosomal subunit protein bL25 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q5P9A5 4.4e-16 72 38 1 88 3 rplY Large ribosomal subunit protein bL25 Anaplasma marginale (strain St. Maries)
Q1RI71 4.48e-16 72 40 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia bellii (strain RML369-C)
A8GVL5 4.48e-16 72 40 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia bellii (strain OSU 85-389)
B2JCN8 4.51e-16 72 47 2 85 3 rplY Large ribosomal subunit protein bL25 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1QED5 6.43e-16 72 44 2 89 3 rplY Large ribosomal subunit protein bL25 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5VYF9 6.83e-16 72 41 1 92 3 rplY Large ribosomal subunit protein bL25 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q83AP1 9.11e-16 72 46 2 89 3 rplY Large ribosomal subunit protein bL25 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAT6 9.11e-16 72 46 2 89 3 rplY Large ribosomal subunit protein bL25 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KF12 9.11e-16 72 46 2 89 3 rplY Large ribosomal subunit protein bL25 Coxiella burnetii (strain Dugway 5J108-111)
B6J329 9.11e-16 72 46 2 89 3 rplY Large ribosomal subunit protein bL25 Coxiella burnetii (strain CbuG_Q212)
B6J9D8 9.11e-16 72 46 2 89 3 rplY Large ribosomal subunit protein bL25 Coxiella burnetii (strain CbuK_Q154)
Q9ZCV3 9.38e-16 71 40 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia prowazekii (strain Madrid E)
Q31IN4 1.01e-15 71 45 2 92 3 rplY Large ribosomal subunit protein bL25 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A6T2S2 1.19e-15 71 45 1 85 3 rplY Large ribosomal subunit protein bL25 Janthinobacterium sp. (strain Marseille)
A5V625 1.52e-15 71 39 1 93 3 rplY Large ribosomal subunit protein bL25 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q68WD3 2.24e-15 70 39 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A5WHA5 4.01e-15 70 41 2 95 3 rplY Large ribosomal subunit protein bL25 Psychrobacter sp. (strain PRwf-1)
Q0AGY6 6.02e-15 69 39 1 92 3 rplY Large ribosomal subunit protein bL25 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q2NAN1 1.17e-14 69 39 1 92 3 rplY Large ribosomal subunit protein bL25 Erythrobacter litoralis (strain HTCC2594)
A4G921 1.46e-14 68 43 1 85 3 rplY Large ribosomal subunit protein bL25 Herminiimonas arsenicoxydans
A1K3G6 1.49e-14 68 39 1 92 3 rplY Large ribosomal subunit protein bL25 Azoarcus sp. (strain BH72)
A4XR55 1.82e-14 68 43 2 93 3 rplY Large ribosomal subunit protein bL25 Pseudomonas mendocina (strain ymp)
Q2RMV5 2.1e-14 68 40 2 92 3 rplY Large ribosomal subunit protein bL25 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q0VS83 4.6e-14 67 41 2 91 3 rplY Large ribosomal subunit protein bL25 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2VZ23 6.85e-14 66 39 1 93 3 rplY Large ribosomal subunit protein bL25 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B2GLJ3 1.71e-13 65 38 2 92 3 rplY Large ribosomal subunit protein bL25 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B8J805 2.67e-13 65 40 1 89 3 rplY Large ribosomal subunit protein bL25 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B4ULC3 3.28e-13 65 40 1 89 3 rplY Large ribosomal subunit protein bL25 Anaeromyxobacter sp. (strain K)
A7H6J6 3.73e-13 65 41 1 89 3 rplY Large ribosomal subunit protein bL25 Anaeromyxobacter sp. (strain Fw109-5)
Q2GII5 8.5e-13 63 32 1 91 3 rplY Large ribosomal subunit protein bL25 Anaplasma phagocytophilum (strain HZ)
Q2IM61 1.65e-12 63 39 1 89 3 rplY Large ribosomal subunit protein bL25 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q741V8 1.71e-12 63 42 3 90 3 rplY Large ribosomal subunit protein bL25 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q82HE6 1.83e-12 63 44 1 88 3 rplY Large ribosomal subunit protein bL25 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1B9E9 2.33e-12 62 40 2 89 3 rplY Large ribosomal subunit protein bL25 Paracoccus denitrificans (strain Pd 1222)
A6UBR5 3.21e-12 62 38 1 90 3 rplY Large ribosomal subunit protein bL25 Sinorhizobium medicae (strain WSM419)
Q21FL7 3.79e-12 62 41 2 91 3 rplY Large ribosomal subunit protein bL25 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5HC84 5.43e-12 62 36 1 91 3 rplY Large ribosomal subunit protein bL25 Ehrlichia ruminantium (strain Welgevonden)
Q5FFA2 5.43e-12 62 36 1 91 3 rplY Large ribosomal subunit protein bL25 Ehrlichia ruminantium (strain Gardel)
Q28L99 6.95e-12 61 38 2 89 3 rplY Large ribosomal subunit protein bL25 Jannaschia sp. (strain CCS1)
Q161I5 6.97e-12 61 39 2 89 3 rplY Large ribosomal subunit protein bL25 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2GHW3 8.55e-12 61 34 1 91 3 rplY Large ribosomal subunit protein bL25 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
P9WHB5 8.73e-12 61 40 2 87 1 rplY Large ribosomal subunit protein bL25 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHB4 8.73e-12 61 40 2 87 3 rplY Large ribosomal subunit protein bL25 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P66122 8.73e-12 61 40 2 87 3 rplY Large ribosomal subunit protein bL25 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8UDA0 1.12e-11 60 36 1 90 3 rplY Large ribosomal subunit protein bL25 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9K3T9 1.44e-11 60 38 3 89 3 rplY Large ribosomal subunit protein bL25 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A7HVD8 1.79e-11 60 38 1 91 3 rplY Large ribosomal subunit protein bL25 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q30ZH2 3.72e-11 59 32 0 90 3 rplY Large ribosomal subunit protein bL25 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B1VFK0 4.99e-11 59 38 2 91 3 rplY Large ribosomal subunit protein bL25 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q5NL76 5.4e-11 59 34 1 92 3 rplY Large ribosomal subunit protein bL25 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B7GS74 5.67e-11 59 36 2 92 3 rplY Large ribosomal subunit protein bL25 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q98HV7 7.64e-11 58 34 1 90 3 rplY Large ribosomal subunit protein bL25 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A6WZE3 8.1e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FZE8 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella suis biovar 1 (strain 1330)
B0CHX4 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YIG3 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REH1 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella melitensis biotype 2 (strain ATCC 23457)
Q57BY2 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella abortus biovar 1 (strain 9-941)
Q2YLX6 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella abortus (strain 2308)
B2S6Z6 8.5e-11 58 35 1 91 3 rplY Large ribosomal subunit protein bL25 Brucella abortus (strain S19)
Q8G5Z8 9.92e-11 58 35 2 92 3 rplY Large ribosomal subunit protein bL25 Bifidobacterium longum (strain NCC 2705)
B3DSB4 9.92e-11 58 35 2 92 3 rplY Large ribosomal subunit protein bL25 Bifidobacterium longum (strain DJO10A)
A9M6K0 1.03e-10 58 35 1 90 3 rplY Large ribosomal subunit protein bL25 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q92N68 1.09e-10 58 36 1 90 3 rplY Large ribosomal subunit protein bL25 Rhizobium meliloti (strain 1021)
A8GSZ5 1.23e-10 58 43 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia rickettsii (strain Sheila Smith)
B0BUI7 1.23e-10 58 43 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia rickettsii (strain Iowa)
Q2RMC2 1.28e-10 58 37 3 97 3 rplY Large ribosomal subunit protein bL25 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C4K1L3 1.29e-10 58 43 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia peacockii (strain Rustic)
Q92H40 1.34e-10 58 43 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PP47 1.34e-10 58 43 1 92 3 rplY Large ribosomal subunit protein bL25 Rickettsia africae (strain ESF-5)
Q3YT12 1.39e-10 58 34 1 91 3 rplY Large ribosomal subunit protein bL25 Ehrlichia canis (strain Jake)
Q6G2L2 2.03e-10 57 36 1 91 3 rplY Large ribosomal subunit protein bL25 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5YPZ5 2.33e-10 57 36 0 88 3 rplY Large ribosomal subunit protein bL25 Nocardia farcinica (strain IFM 10152)
B0UGY1 2.42e-10 57 34 2 93 3 rplY Large ribosomal subunit protein bL25 Methylobacterium sp. (strain 4-46)
A5FZ47 2.55e-10 57 36 3 94 3 rplY Large ribosomal subunit protein bL25 Acidiphilium cryptum (strain JF-5)
Q4JU40 3.03e-10 57 36 2 92 3 rplY Large ribosomal subunit protein bL25 Corynebacterium jeikeium (strain K411)
Q6AJL8 3.39e-10 56 32 2 89 3 rplY Large ribosomal subunit protein bL25 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q2J5Z0 3.8e-10 57 41 4 91 3 rplY Large ribosomal subunit protein bL25 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q2K5U4 4.2e-10 57 35 1 90 3 rplY Large ribosomal subunit protein bL25 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9CD48 5.58e-10 56 35 0 88 3 rplY Large ribosomal subunit protein bL25 Mycobacterium leprae (strain TN)
Q6ADQ7 6.95e-10 56 40 3 90 3 rplY Large ribosomal subunit protein bL25 Leifsonia xyli subsp. xyli (strain CTCB07)
Q7VRX2 8.03e-10 54 33 3 95 3 rplY Large ribosomal subunit protein bL25 Blochmanniella floridana
Q11GC6 8.52e-10 56 34 1 90 3 rplY Large ribosomal subunit protein bL25 Chelativorans sp. (strain BNC1)
B2IG64 8.84e-10 56 32 1 91 3 rplY Large ribosomal subunit protein bL25 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q7MXK8 9.28e-10 55 32 2 85 3 rplY Large ribosomal subunit protein bL25 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RHF3 9.28e-10 55 32 2 85 3 rplY Large ribosomal subunit protein bL25 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B0S2F8 1.63e-09 55 29 0 87 3 rplY Large ribosomal subunit protein bL25 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A8LRY8 1.99e-09 55 37 2 89 3 rplY Large ribosomal subunit protein bL25 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B1Z970 2.29e-09 55 35 2 94 3 rplY Large ribosomal subunit protein bL25 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q5LV90 3.81e-09 54 37 2 86 3 rplY Large ribosomal subunit protein bL25 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q6AAC8 4.01e-09 54 34 3 93 1 rplY Large ribosomal subunit protein bL25 Cutibacterium acnes (strain DSM 16379 / KPA171202)
A9W5L4 5.35e-09 54 36 3 96 3 rplY Large ribosomal subunit protein bL25 Methylorubrum extorquens (strain PA1)
B7KNU8 5.41e-09 53 36 3 96 3 rplY Large ribosomal subunit protein bL25 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A5CF34 6.12e-09 53 33 1 92 3 rplY Large ribosomal subunit protein bL25 Orientia tsutsugamushi (strain Boryong)
A6GVZ1 7.23e-09 53 33 1 89 3 rplY Large ribosomal subunit protein bL25 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q74FE7 7.52e-09 53 33 2 93 3 rplY Large ribosomal subunit protein bL25 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B3CTF9 7.68e-09 53 33 1 92 3 rplY Large ribosomal subunit protein bL25 Orientia tsutsugamushi (strain Ikeda)
Q0ARN7 8.02e-09 53 35 3 94 3 rplY Large ribosomal subunit protein bL25 Maricaulis maris (strain MCS10)
Q3AFL7 8.89e-09 53 32 2 93 3 rplY Large ribosomal subunit protein bL25 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
C4XHR1 1.2e-08 52 31 0 88 3 rplY Large ribosomal subunit protein bL25 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A5FKV4 1.24e-08 52 32 1 91 3 rplY Large ribosomal subunit protein bL25 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B8IFN5 1.48e-08 52 33 2 93 3 rplY Large ribosomal subunit protein bL25 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A9GXJ8 2.53e-08 52 34 2 94 3 rplY Large ribosomal subunit protein bL25 Sorangium cellulosum (strain So ce56)
Q6G0F8 3.17e-08 52 32 1 91 3 rplY Large ribosomal subunit protein bL25 Bartonella quintana (strain Toulouse)
Q5GTJ0 3.87e-08 51 36 2 92 3 rplY Large ribosomal subunit protein bL25 Wolbachia sp. subsp. Brugia malayi (strain TRS)
A1UTH4 4.9e-08 51 34 2 92 3 rplY Large ribosomal subunit protein bL25 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A9IR85 4.91e-08 51 32 1 91 3 rplY Large ribosomal subunit protein bL25 Bartonella tribocorum (strain CIP 105476 / IBS 506)
C1AY16 7.19e-08 50 34 0 86 3 rplY Large ribosomal subunit protein bL25 Rhodococcus opacus (strain B4)
Q8NRV2 7.35e-08 50 33 3 93 3 rplY Large ribosomal subunit protein bL25 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q64X29 8.35e-08 50 35 3 85 3 rplY Large ribosomal subunit protein bL25 Bacteroides fragilis (strain YCH46)
Q5LG55 8.35e-08 50 35 3 85 3 rplY Large ribosomal subunit protein bL25 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B3CMB8 1.12e-07 50 32 1 91 3 rplY Large ribosomal subunit protein bL25 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
B8D015 1.23e-07 50 36 4 91 3 rplY Large ribosomal subunit protein bL25 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B0K664 1.25e-07 50 29 2 95 3 rplY Large ribosomal subunit protein bL25 Thermoanaerobacter sp. (strain X514)
B0K775 1.25e-07 50 29 2 95 3 rplY Large ribosomal subunit protein bL25 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A4QCR9 1.29e-07 50 33 3 93 3 rplY Large ribosomal subunit protein bL25 Corynebacterium glutamicum (strain R)
B1LZ78 1.29e-07 50 32 2 94 3 rplY Large ribosomal subunit protein bL25 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B2KE95 2.14e-07 49 35 4 93 3 rplY Large ribosomal subunit protein bL25 Elusimicrobium minutum (strain Pei191)
B1LBD7 2.24e-07 49 31 3 101 3 rplY Large ribosomal subunit protein bL25 Thermotoga sp. (strain RQ2)
A0LPH1 2.55e-07 49 32 3 95 3 rplY Large ribosomal subunit protein bL25 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A0M745 2.66e-07 49 28 0 91 3 rplY Large ribosomal subunit protein bL25 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q0S4R2 2.83e-07 49 32 2 89 3 rplY Large ribosomal subunit protein bL25 Rhodococcus jostii (strain RHA1)
Q1GK67 3.18e-07 49 35 2 91 3 rplY Large ribosomal subunit protein bL25 Ruegeria sp. (strain TM1040)
C5C9D7 3.27e-07 48 37 3 94 3 rplY Large ribosomal subunit protein bL25 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B5EHX2 3.41e-07 48 55 0 40 3 rplY Large ribosomal subunit protein bL25 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A9HC01 3.48e-07 48 30 1 73 3 rplY Large ribosomal subunit protein bL25 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A1WVQ2 4.55e-07 48 41 1 92 3 rplY Large ribosomal subunit protein bL25 Halorhodospira halophila (strain DSM 244 / SL1)
A1AM04 5.01e-07 48 30 1 92 3 rplY Large ribosomal subunit protein bL25 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B8EK41 5.86e-07 48 32 1 91 3 rplY Large ribosomal subunit protein bL25 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B3E6G0 5.89e-07 48 37 1 89 3 rplY Large ribosomal subunit protein bL25 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B8GZU9 6.69e-07 48 29 2 97 3 rplY Large ribosomal subunit protein bL25 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AAV8 6.69e-07 48 29 2 97 3 rplY Large ribosomal subunit protein bL25 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C0QAZ0 6.87e-07 48 30 4 96 3 rplY Large ribosomal subunit protein bL25 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B4R8Q7 7.35e-07 48 29 1 92 3 rplY Large ribosomal subunit protein bL25 Phenylobacterium zucineum (strain HLK1)
A5ILV5 8.3e-07 48 30 3 101 3 rplY Large ribosomal subunit protein bL25 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q2LUK6 1.17e-06 47 30 1 91 3 rplY Large ribosomal subunit protein bL25 Syntrophus aciditrophicus (strain SB)
B5YG55 1.69e-06 47 31 3 92 3 rplY Large ribosomal subunit protein bL25 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q7A1S4 1.77e-06 47 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain MW2)
Q6GBY7 1.77e-06 47 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain MSSA476)
Q7A7B3 1.77e-06 47 32 1 92 1 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain N315)
Q99WA2 1.77e-06 47 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIH4 1.77e-06 47 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain COL)
Q2YVY4 1.77e-06 47 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FJE0 1.77e-06 47 32 1 92 1 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain USA300)
Q6GJH0 1.96e-06 47 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus aureus (strain MRSA252)
Q4FPH0 2.31e-06 47 31 1 93 3 rplY Large ribosomal subunit protein bL25 Pelagibacter ubique (strain HTCC1062)
C6E500 2.52e-06 46 52 0 40 3 rplY Large ribosomal subunit protein bL25 Geobacter sp. (strain M21)
B9M5U4 2.56e-06 46 51 0 39 3 rplY Large ribosomal subunit protein bL25 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q83FQ8 3.1e-06 46 35 2 91 3 rplY Large ribosomal subunit protein bL25 Tropheryma whipplei (strain Twist)
Q5FRT8 3.32e-06 46 36 2 74 3 rplY Large ribosomal subunit protein bL25 Gluconobacter oxydans (strain 621H)
A6L6X0 3.35e-06 46 31 3 95 3 rplY Large ribosomal subunit protein bL25 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q83HD6 3.62e-06 46 35 2 91 3 rplY Large ribosomal subunit protein bL25 Tropheryma whipplei (strain TW08/27)
Q39RQ9 4.22e-06 45 46 0 41 3 rplY Large ribosomal subunit protein bL25 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8R8L3 4.3e-06 45 30 2 93 3 rplY Large ribosomal subunit protein bL25 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B0T899 4.48e-06 45 31 1 92 3 rplY Large ribosomal subunit protein bL25 Caulobacter sp. (strain K31)
Q4L3F8 5.19e-06 45 31 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus haemolyticus (strain JCSC1435)
Q67M29 5.21e-06 45 30 3 88 3 rplY1 Large ribosomal subunit protein bL25A Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q11RT6 5.6e-06 45 36 3 86 3 rplY Large ribosomal subunit protein bL25 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q5HRQ4 5.74e-06 45 31 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CQU8 5.8e-06 45 31 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
C0R595 6.62e-06 45 30 1 91 3 rplY Large ribosomal subunit protein bL25 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q73II9 6.62e-06 45 30 1 91 3 rplY Large ribosomal subunit protein bL25 Wolbachia pipientis wMel
B6YQC3 7.07e-06 45 28 1 80 3 rplY Large ribosomal subunit protein bL25 Azobacteroides pseudotrichonymphae genomovar. CFP2
Q89YZ1 7.44e-06 45 32 3 85 3 rplY Large ribosomal subunit protein bL25 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A7NI71 7.88e-06 45 32 2 89 3 rplY Large ribosomal subunit protein bL25 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5G7R6 8.12e-06 45 50 0 40 3 rplY Large ribosomal subunit protein bL25 Geotalea uraniireducens (strain Rf4)
C1A348 8.39e-06 45 30 2 89 3 rplY Large ribosomal subunit protein bL25 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B9DLD8 9.54e-06 45 34 1 83 3 rplY Large ribosomal subunit protein bL25 Staphylococcus carnosus (strain TM300)
Q47SW3 1.18e-05 44 41 2 89 3 rplY Large ribosomal subunit protein bL25 Thermobifida fusca (strain YX)
Q8EU33 1.34e-05 44 26 0 87 3 rplY Large ribosomal subunit protein bL25 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8ZXZ4 1.73e-05 44 34 4 91 3 rplY Large ribosomal subunit protein bL25 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q49V10 2.23e-05 44 32 1 92 3 rplY Large ribosomal subunit protein bL25 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8FQV5 2.31e-05 43 30 1 90 3 rplY Large ribosomal subunit protein bL25 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B6JIP4 2.44e-05 44 37 1 90 3 rplY Large ribosomal subunit protein bL25 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B9K7S4 2.86e-05 43 27 3 101 3 rplY Large ribosomal subunit protein bL25 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A4J0Q5 3.09e-05 43 29 1 88 3 rplY Large ribosomal subunit protein bL25 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A8F919 3.09e-05 43 25 0 90 3 rplY Large ribosomal subunit protein bL25 Bacillus pumilus (strain SAFR-032)
A5UQF4 3.11e-05 43 32 4 93 3 rplY Large ribosomal subunit protein bL25 Roseiflexus sp. (strain RS-1)
P14194 3.12e-05 43 28 0 90 1 ctc General stress protein Ctc Bacillus subtilis (strain 168)
Q8YAD3 4.98e-05 43 30 0 89 3 rplY Large ribosomal subunit protein bL25 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q724K2 4.98e-05 43 30 0 89 3 rplY Large ribosomal subunit protein bL25 Listeria monocytogenes serotype 4b (strain F2365)
Q92F64 4.98e-05 43 30 0 89 3 rplY Large ribosomal subunit protein bL25 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q2GEA0 6.16e-05 42 26 0 93 3 rplY Large ribosomal subunit protein bL25 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
B8FLB8 7.05e-05 42 28 2 90 3 rplY Large ribosomal subunit protein bL25 Desulfatibacillum aliphaticivorans
B9LA47 7.5e-05 42 31 1 86 3 rplY Large ribosomal subunit protein bL25 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B8J0S7 8.57e-05 42 33 2 92 3 rplY Large ribosomal subunit protein bL25 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A7Z0H5 9.43e-05 42 26 0 90 3 rplY Large ribosomal subunit protein bL25 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q131L9 9.98e-05 42 34 1 93 3 rplY Large ribosomal subunit protein bL25 Rhodopseudomonas palustris (strain BisB5)
Q67M16 0.000103 42 29 1 82 3 rplY2 Large ribosomal subunit protein bL25B Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A6L8V4 0.000114 42 30 2 83 3 rplY Large ribosomal subunit protein bL25 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q2ISF7 0.000114 42 32 1 93 3 rplY Large ribosomal subunit protein bL25 Rhodopseudomonas palustris (strain HaA2)
Q0B0S7 0.000148 42 29 3 93 3 rplY Large ribosomal subunit protein bL25 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A8HS67 0.000158 41 37 1 90 3 rplY Large ribosomal subunit protein bL25 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8DKL6 0.000175 41 30 4 98 3 rplY Large ribosomal subunit protein bL25 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q73N16 0.000179 41 28 2 96 3 rplY Large ribosomal subunit protein bL25 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A4IJC8 0.000195 41 26 0 89 3 rplY Large ribosomal subunit protein bL25 Geobacillus thermodenitrificans (strain NG80-2)
Q8DLG3 0.000261 40 34 4 95 3 rplY Large ribosomal subunit protein bL25 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B3Q7X4 0.00029 41 34 1 93 3 rplY Large ribosomal subunit protein bL25 Rhodopseudomonas palustris (strain TIE-1)
Q6N1P8 0.00029 41 34 1 93 1 rplY Large ribosomal subunit protein bL25 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B3ERN9 0.000348 40 32 2 84 3 rplY Large ribosomal subunit protein bL25 Amoebophilus asiaticus (strain 5a2)
Q07RP7 0.000435 40 35 1 90 3 rplY Large ribosomal subunit protein bL25 Rhodopseudomonas palustris (strain BisA53)
B1HSV6 0.000451 40 27 1 92 3 rplY Large ribosomal subunit protein bL25 Lysinibacillus sphaericus (strain C3-41)
B3EPZ5 0.000453 40 31 1 89 3 rplY Large ribosomal subunit protein bL25 Chlorobium phaeobacteroides (strain BS1)
A1VDR0 0.000475 40 31 2 93 3 rplY Large ribosomal subunit protein bL25 Nitratidesulfovibrio vulgaris (strain DP4)
Q72BR0 0.000475 40 31 2 93 3 rplY Large ribosomal subunit protein bL25 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P73289 0.000597 38 30 4 97 3 rplY Large ribosomal subunit protein bL25 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B7IFM6 0.00062 40 32 3 95 3 rplY Large ribosomal subunit protein bL25 Thermosipho africanus (strain TCF52B)
Q6NI77 0.000713 40 29 3 94 3 rplY Large ribosomal subunit protein bL25 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B2UL21 0.000716 39 31 2 89 3 rplY Large ribosomal subunit protein bL25 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_15700
Feature type CDS
Gene rplY
Product 50S ribosomal protein L25
Location 110437 - 110718 (strand: 1)
Length 282 (nucleotides) / 93 (amino acids)

Contig

Accession ZDB_226
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1986
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01386 Ribosomal L25p family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1825 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L25 (general stress protein Ctc)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02897 large subunit ribosomal protein L25 Ribosome -

Protein Sequence

MLTINAELRKEQGKGASRRLRRANKFPAIVYGGNQEPVSIELDHDVLINQEAKPEFYEVLNLVIDGKETKVKVQAVQRHPFKPKLTHIDFLRA

Flanking regions ( +/- flanking 50bp)

TGGGTCGCCTGTAGCAAAGATTTTTTTTACTCTTGTTAAAGAGAAAAGTTATGTTAACTATCAATGCTGAATTACGTAAAGAGCAGGGTAAGGGTGCGAGCCGCCGCCTGCGTCGCGCAAACAAGTTCCCTGCTATCGTTTATGGTGGCAACCAGGAACCTGTTTCCATCGAACTGGACCACGACGTCCTGATCAACCAGGAAGCTAAACCAGAATTTTACGAAGTTCTGAACCTGGTTATCGATGGTAAAGAAACCAAAGTGAAAGTACAGGCTGTACAGCGTCATCCGTTCAAGCCAAAACTGACACACATCGATTTCCTGCGCGCTTAATTACGCCACCTATCGAGCTTTAATCGGGACGCCGAGTAAATAACGCCGCT